DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2121 and Unc93a

Sequence 1:NP_001137618.1 Gene:CG2121 FlyBaseID:FBgn0033289 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_008757004.1 Gene:Unc93a RGDID:1583290 Length:454 Species:Rattus norvegicus

Alignment Length:459 Identity:145/460 (32%)
Similarity:243/460 (53%) Gaps:27/460 (6%)


  Fly    79 KNVVVIGLAFMIHFTAFHGTSNLQSSVNADKALGTTTLAVIYGSLILSNIFLPMTVIRWFGCRLT 143
            |||:|:...|::.|||:.|..|||||:.:...||..||:.:|||::||::|||..:|:..||:.|
  Rat     6 KNVLVVACGFLLLFTAYGGLQNLQSSLYSAHGLGVATLSTLYGSVLLSSMFLPPILIKKCGCKWT 70

  Fly   144 MALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYLSTVSEALTQVRGNKSRKDVN 208
            :..::..|:.:....|:..:.||||.::::|.|..|||.::||||:.:.....:..|...:..||
  Rat    71 IVGSMCCYVVFSLGNFHANWYTLIPTSILLGLGAAPLWSAQCTYLTVIGNLQAEKVGKLGKDVVN 135

  Fly   209 TVKFFGLFFIFYQMAQVWGNLISSSVLTLSAPAAQSAANDSFELEVQRELERNRVAELCGARFCP 273
              ::||:||:.:|.:.||||||||  |.....:.|.|..|...:.             |||:.|.
  Rat   136 --QYFGIFFLIFQSSGVWGNLISS--LVFGKMSMQDAIPDEQLMS-------------CGAKDCL 183

  Fly   274 GVGAEANPNLVPPAPEQIQLLNSIFLTCMAAAVVMMIFGVSSLKRYGVKRGDTGDGMSGLKLLTV 338
             :|..|......|:.:.|..|..|:.:....|::::...:..:|......|:|........||: 
  Rat   184 -MGPSATNTTHHPSQQLIYTLLGIYTSSGVLAILLVAVFLEPVKDKLENEGETRSRPLWSTLLS- 246

  Fly   339 TINLLRKRRQILMLPITMFIGLEEAFLAVDFTRSFVACGWGISRIGFAMICFGVANAVAAGIAGA 403
            |..|.|.:|..|::.:.::.|.::.||:.::|:|:|.|..||..:|:.||||....|:.:.:.|.
  Rat   247 TFMLFRDKRLCLLMFLPVYSGFQQGFLSGEYTKSYVTCALGIRFVGYVMICFSAMTALCSLLYGK 311

  Fly   404 LVERIGRVTLAALCAVVNLCLLTYMYTWEAREGDYMSYCTFAAVWGICDGVWLVVVNAFYGILFP 468
            :.:..||:||..|.|.::...:.....|.........:...:.:||:.|.||....|..:|:||.
  Rat   312 ISKYTGRITLYVLGAAIHFSCIVVFLLWHPNPAQLPVFFVLSGLWGMADAVWQTQNNVLFGVLFE 376

  Fly   469 NHLIAAYSNFRLWESTGSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRFWQ-------- 525
            .:...|::|:||.|:.|.||.:..||.||.||||.||:..:.|..|.||.:|||.::        
  Rat   377 ENKEPAFANYRLGEAVGFVIAFGYSSFLCVSTKLYILLGVLSVAMVSYGTVEYREYKAASKVLAA 441

  Fly   526 KQKN 529
            ::||
  Rat   442 EEKN 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2121NP_001137618.1 MFS 84..>189 CDD:304372 41/105 (39%)
MFS_1 <296..476 CDD:284993 45/180 (25%)
Unc93aXP_008757004.1 MFS 8..424 CDD:119392 136/435 (31%)
MFS_1 10..379 CDD:284993 115/388 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335097800
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 1 1.000 FOG0002669
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19444
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.