DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2121 and Unc93b1

Sequence 1:NP_001137618.1 Gene:CG2121 FlyBaseID:FBgn0033289 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_062322.2 Gene:Unc93b1 MGIID:1859307 Length:619 Species:Mus musculus

Alignment Length:523 Identity:98/524 (19%)
Similarity:208/524 (40%) Gaps:98/524 (19%)


  Fly    58 PNGDNKVNQRHYEPAERFIITKNVVVIGLAFMIHFTAFHGTSNLQSSVNADKALGTTTLAVIYGS 122
            ||.:.:..:|.|...:|..:.|||:.......:.:..:.|...:|..::.|:    |...|.||:
Mouse    62 PNYNEEEEERRYYRRKRLGVVKNVLAASTGVTLTYGVYLGLLQMQLILHYDE----TYREVKYGN 122

  Fly   123 LILSNI-----------------FLPMTVIRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAA 170
            :.|.:|                 :.|: :||:||.:..|.||:..|..:::..::.|:.||:|:|
Mouse   123 MGLPDIDSKMLMGINVTPIAALLYTPV-LIRFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSA 186

  Fly   171 LMVGFGGGPLWCSKCTYLSTVSEALTQVRGNKSRKDVN-------------TVKFFGLFFIFYQM 222
            :.:|....|||.|...|::.:|:...:....|.:.:..             .:.|..:|:.|:.:
Mouse   187 VALGMAIVPLWASMGNYITRMSQKYYEYSHYKEQDEQGPQQRPPRGSHAPYLLVFQAIFYSFFHL 251

  Fly   223 AQVWGNL------------ISSSVLTLSAPAAQS-AANDSFELEVQRELERNRVAELCGARFCPG 274
            :.....|            ::.:::.:.:...:| ...:.|...|.|.|.|::            
Mouse   252 SFACAQLPMIYFLNNYLYDLNHTLINVQSCGTKSQGILNGFNKTVLRTLPRSK------------ 304

  Fly   275 VGAEANPNLVPPAPEQIQLLNSIFLTCMAAAVVMMIFGVSSLKRYGVKRGD---TGDGMSGLKLL 336
                   ||:        ::.|: |..:|...::|:.|:........:..|   .|.|    .:.
Mouse   305 -------NLI--------VVESV-LMAVAFLAMLMVLGLCGAAYRPTEEIDLRSVGWG----NIF 349

  Fly   337 TVTINLLRKRRQILMLPITMFIGLEEAFLAVDFTRSFVACGWGISRIGFAMICFGVANAVAAGIA 401
            .:....:|..|...::|..::.|.|..|....|...:..|..|:.|:.:.:|.:.: .|.|:.:.
Mouse   350 QLPFKHVRDFRLRHLVPFFIYSGFEVLFACTGFALGYGVCSMGLERLAYLLIAYSL-GASASSVL 413

  Fly   402 GALVERIGRVTLAALCAVVNLCLLTYMYTW----EAREGDYMSYCTFAAVWGICDGVWLVVVNAF 462
            |.|...:.|.......|.::|.|...::.|    ...:..::.|.. ||:||:...:....::..
Mouse   414 GLLGLWLPRSVPLVAGAGLHLLLTLSLFFWAPAPRVLQHSWIFYFV-AALWGVGSALNKTGLSTL 477

  Fly   463 YGILFPN--HLIAAYSNFRLWESTGSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRFWQ 525
            .|||:.:  .....::.:..|::....:.| :.|.|....||.:|::.::.....|      .|.
Mouse   478 LGILYEDKERQDFIFTIYHWWQAVAIFVVY-LGSSLPMKAKLAVLLVTLVAAAASY------LWM 535

  Fly   526 KQK 528
            :||
Mouse   536 EQK 538

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2121NP_001137618.1 MFS 84..>189 CDD:304372 29/122 (24%)
MFS_1 <296..476 CDD:284993 36/189 (19%)
Unc93b1NP_062322.2 MFS <145..>210 CDD:304372 21/66 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335095113
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.