DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2121 and CG4928

Sequence 1:NP_001137618.1 Gene:CG2121 FlyBaseID:FBgn0033289 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_573179.1 Gene:CG4928 FlyBaseID:FBgn0027556 Length:538 Species:Drosophila melanogaster

Alignment Length:463 Identity:191/464 (41%)
Similarity:295/464 (64%) Gaps:14/464 (3%)


  Fly    71 PAERFIITKNVVVIGLAFMIHFTAFHGTSNLQSSVNADKALGTTTLAVIYGSLILSNIFLPMTVI 135
            |.|::.|.||:.:|.:|||:.||||.||:|||||:||...|||.:|:.||.:|::|.||||..:|
  Fly    36 PGEKWRILKNISIISIAFMVQFTAFQGTANLQSSINAKDGLGTVSLSAIYAALVVSCIFLPTLII 100

  Fly   136 RWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYLSTVSEALTQVRG 200
            |....:.|:..::..|.||||.|.:|||.||:||.::||.|..|:|.||.|||:.|.:...::  
  Fly   101 RKLTVKWTLVCSMLCYAPYIAFQLFPRFYTLVPAGILVGMGAAPMWASKATYLTQVGQVYAKI-- 163

  Fly   201 NKSRKDVNTVKFFGLFFIFYQMAQVWGNLISSSVLTLSAPAAQSAANDSFELEVQRELERNRVAE 265
            .:...|...|:|||.||:.:|.|::|||||||.||:..|....|::|.:..   :.:|      :
  Fly   164 TEQAVDAIIVRFFGFFFLAWQSAELWGNLISSLVLSSGAHGGGSSSNTTVS---EEDL------Q 219

  Fly   266 LCGARFCPGVGAEANPNLVPPAPEQIQLLNSIFLTCMAAAVVMMIFGVSSLKRYGVKR--GDTGD 328
            .|||.||. .|:..:.||..|..::|..::.|:|:|:.|||.::.|.:..|||||.||  .::..
  Fly   220 FCGANFCT-TGSGGHGNLERPPEDEIFEISMIYLSCIVAAVCIIAFFLDPLKRYGEKRKGSNSAA 283

  Fly   329 GMSGLKLLTVTINLLRKRRQILMLPITMFIGLEEAFLAVDFTRSFVACGWGISRIGFAMICFGVA 393
            .:|||:||:.|...::|....|::|||:|||:|:||:..|||:::|||..|:::|||.||||||.
  Fly   284 ELSGLQLLSATFRQMKKPNLQLLIPITVFIGMEQAFIGADFTQAYVACALGVNKIGFVMICFGVV 348

  Fly   394 NAVAAGIAGALVERIGRVTLAALCAVVNLCLLTYMYTWEAREGDYMSYCTFAAVWGICDGVWLVV 458
            ||:.:.:.|::::.|||..:..|.|||:..|:|....|.....:.:.:...:.:||:.|.||...
  Fly   349 NALCSILFGSVMKYIGRTPIIVLGAVVHFTLITVELFWRPNPDNPIIFYAMSGLWGVGDAVWQTQ 413

  Fly   459 VNAFYGILFPNHLIAAYSNFRLWESTGSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRF 523
            :|..||:||..:..||:||:|||||.|.||.|..::.|||..||.||:..:.:||:||.::|..:
  Fly   414 INGLYGLLFRRNKEAAFSNYRLWESAGFVIAYAYATTLCTQMKLYILLAVLTLGCIGYVIVEILY 478

  Fly   524 WQKQKNLE 531
            .:||:.|:
  Fly   479 RKKQRKLK 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2121NP_001137618.1 MFS 84..>189 CDD:304372 55/105 (52%)
MFS_1 <296..476 CDD:284993 72/182 (40%)
CG4928NP_573179.1 MFS 49..>155 CDD:328737 55/106 (52%)
MFS_1 <255..426 CDD:331686 67/171 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334115764
eggNOG 1 0.900 E1_KOG3097
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1593
Isobase 1 0.950 0 Normalized mean entropy S4703
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 1 1.000 FOG0002669
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19444
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2890
87.970

Return to query results.
Submit another query.