DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2121 and Y52E8A.6

Sequence 1:NP_001137618.1 Gene:CG2121 FlyBaseID:FBgn0033289 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001263659.1 Gene:Y52E8A.6 WormBaseID:WBGene00021798 Length:436 Species:Caenorhabditis elegans

Alignment Length:507 Identity:94/508 (19%)
Similarity:185/508 (36%) Gaps:129/508 (25%)


  Fly    78 TKNVVVIGLAFMIHFTAFHGTSNLQSSV---------NADKALGTTTLAVIYGSLILSNIFLPMT 133
            ||||:.:.::|::.|.|:.....:|..:         |.|...|..:.|:.|....||.:|: ..
 Worm     7 TKNVLRLSISFLLLFFAYMSQEYIQEPLIEEKHKTGGNIDPHAGYHSFAITYFFFTLSCLFV-AP 70

  Fly   134 VIRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYL--STVSEALT 196
            :|.....:..|.|...||:.:.....:.....:...:..:|.||..:|..:..||  :..||.: 
 Worm    71 IIDKISAKWGMVLRFSAYIAFQYGFIHMNTYYVYITSASLGVGGAFIWVGQGKYLTENCTSETI- 134

  Fly   197 QVRGNKSRKDVNTVKFF--------GLFF--IFYQMAQVWGNLISSSVLTLSAPAAQSAANDSFE 251
                   .:::....|.        |:|.  :||.  |.....:.|.                  
 Worm   135 -------ERNIALTWFIFKFCLLGGGIFLYVLFYN--QKMNEFLESG------------------ 172

  Fly   252 LEVQRELERNRVAELCGARFCPGVGAEANPNLVPPAPEQIQLLNSIFLTCMAAAVVMMIFGVSSL 316
                   :......:|    |                 .|.||.:|....:..:|.     |...
 Worm   173 -------DYKTFVYIC----C-----------------SISLLAAINTAFLPQSVY-----VPER 204

  Fly   317 KRYGVKRGDTGDGMSGLKLLTVTINLLRKRRQILMLPITMFIGLEEAF------LAVDFTRSFVA 375
            |::          .:..|.|..|..::|:...:|::.|.::.|...:|      ..:.||   .|
 Worm   205 KKH----------ETFAKTLKATFKIMRESPMLLLVSIFLYTGFSRSFWIAIYPTCIKFT---PA 256

  Fly   376 CGWGISRIGFAM--ICFGVANAVAAGIAGALVERI---GRVTLAALCAVVNL-C-LLTYMY---- 429
            .|...::: .||  |..|:...||.||...|.:|:   |:..:..:..|::| | :|.|::    
 Worm   257 LGDNTAKL-LAMSGIATGIGQIVAGGIFSVLGKRVRILGKDMIVVIACVLHLICFVLIYLFFPYD 320

  Fly   430 ----------TWEAREGDYMS-YCTFAAVWGICDGVWLVVVNAFYGILFPNHLIAAYSNFRLWES 483
                      |:|...  |:: :|  :.:.|..|.:....|.:|....:......|::.|:.:.:
 Worm   321 APLHPTQNVGTFEPNA--YIAIFC--SGLLGFGDAIIQTQVYSFLCDGYSEESSHAFALFKFYSA 381

  Fly   484 TGSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRFWQKQKNLEVMLS 535
            ..|.|.:.:|.....:..||:..:|.::..:...|.:..::.|.::|.:.||
 Worm   382 ISSTIAFFVSKYFTLAGHLVLYGVFAILSAITTVLAQRLYFHKTRHLNLNLS 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2121NP_001137618.1 MFS 84..>189 CDD:304372 23/116 (20%)
MFS_1 <296..476 CDD:284993 41/208 (20%)
Y52E8A.6NP_001263659.1 MFS 13..165 CDD:304372 31/163 (19%)
MFS_1 17..387 CDD:284993 81/450 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.