DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2121 and unc93a

Sequence 1:NP_001137618.1 Gene:CG2121 FlyBaseID:FBgn0033289 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_002931523.1 Gene:unc93a XenbaseID:XB-GENE-5800507 Length:460 Species:Xenopus tropicalis

Alignment Length:452 Identity:170/453 (38%)
Similarity:260/453 (57%) Gaps:20/453 (4%)


  Fly    79 KNVVVIGLAFMIHFTAFHGTSNLQSSVNADKALGTTTLAVIYGSLILSNIFLPMTVIRWFGCRLT 143
            ||::::...|::.||||.|..:||||:|:|:.||..:|:||||:||:|::|:|..:|:..||:.|
 Frog     5 KNILIVSFGFLLLFTAFGGLQSLQSSLNSDEGLGVASLSVIYGALIISSVFVPSILIKKIGCKWT 69

  Fly   144 MALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYLSTVSEALTQVRGNKSRKDVN 208
            :..::..|:.|....||..:.||||.:|::||||.|||.:|||||:.......:.:|..::..||
 Frog    70 IVASMCCYITYSLGNFYASWYTLIPTSLILGFGGAPLWAAKCTYLTESGNRYAEKKGKLAKDIVN 134

  Fly   209 TVKFFGLFFIFYQMAQVWGNLISSSVLTLSAPAAQSAANDSFELEVQRELERNRVAELCGARFCP 273
              ::|||||:.:|.:.||||||||.:....:||   .:|:||.           ....|||..||
 Frog   135 --QYFGLFFLIFQSSGVWGNLISSLIFGQDSPA---GSNNSFP-----------DYSHCGANDCP 183

  Fly   274 GVGAEANPNLVPPAPEQIQLLNSIFLTCMAAAVVM--MIFGVSSLKRYGVKRGDTGDGMSGLKLL 336
            |.........:.|....|..|..::......||::  :.....:|:...:|.|...:  |.:|.:
 Frog   184 GSNFGNGTGSIKPTQSLIYTLLGVYTGSGVLAVILIAVFLDTINLRTDQLKPGTKEE--SFIKKI 246

  Fly   337 TVTINLLRKRRQILMLPITMFIGLEEAFLAVDFTRSFVACGWGISRIGFAMICFGVANAVAAGIA 401
            ..||..|:.:||.|::|:||:.|.|:.|||.|:|:|:|.|..||..:|:.||||...|||.:.:.
 Frog   247 LATIRHLKDKRQCLLIPLTMYSGFEQGFLAGDYTKSYVTCSLGIHFVGYVMICFAATNAVCSLLF 311

  Fly   402 GALVERIGRVTLAALCAVVNLCLLTYMYTWEAREGDYMSYCTFAAVWGICDGVWLVVVNAFYGIL 466
            |.|.:..||:.|..:.||:|...:..:..|:....|:..:..|.|:|||.|.||....||.||:|
 Frog   312 GQLSKYTGRIFLFIMAAVLNAASIIALLLWQPHPNDFAVFFIFPAIWGIADAVWQTQTNALYGVL 376

  Fly   467 FPNHLIAAYSNFRLWESTGSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRFWQKQK 528
            |..|..||::|:|||||.|.||.|..|:.||.|.||.||:..:|:..|.||.:||..:.:.|
 Frog   377 FDEHKEAAFANYRLWESLGFVIAYGYSTFLCVSIKLYILLAVLLIAIVLYGCVEYLEYVEHK 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2121NP_001137618.1 MFS 84..>189 CDD:304372 49/105 (47%)
MFS_1 <296..476 CDD:284993 63/182 (35%)
unc93aXP_002931523.1 MFS_1 7..399 CDD:284993 152/410 (37%)
MFS 10..168 CDD:304372 68/163 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335085182
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 1 1.000 FOG0002669
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.