DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2121 and unc93b1

Sequence 1:NP_001137618.1 Gene:CG2121 FlyBaseID:FBgn0033289 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001275745.1 Gene:unc93b1 ZFINID:ZDB-GENE-130424-1 Length:623 Species:Danio rerio

Alignment Length:560 Identity:124/561 (22%)
Similarity:235/561 (42%) Gaps:87/561 (16%)


  Fly    10 DPELDMVYPSDTSDANNEELALEHSVAHGNVHGNGTGTGGSSPGTTTAPNGDNKVNQRHYEPAER 74
            :.|||...|::..|..      :.....||:.|......|..      |:.|.:..:|.|...:|
Zfish    13 EAELDGAPPAEAEDPP------QLPGPEGNIQGQVEEFLGPH------PDYDEEEEERKYYRRKR 65

  Fly    75 FIITKNVVVIGLAFMIHFTAFHGTSNLQSSVNADKALGTTTLAVIYGSLILSNI----------- 128
            ..:.||||......||.::.:.|...:|..::.|:    |...|.||:|.|.:|           
Zfish    66 LGVVKNVVGASCGGMIIYSVYMGLLQMQLILHYDE----TYREVKYGTLGLEDIDNKMLMGINVT 126

  Fly   129 ------FLPMTVIRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTY 187
                  :.|: :||:.|.:..|.||...|..:::..::.|:.||:|:|:.:|....|||.|...|
Zfish   127 PIVGLLYTPV-LIRFLGTKWMMFLASGIYALFVSTNYWERYYTLVPSAVAIGVVIVPLWASMGNY 190

  Fly   188 LSTVSEALTQVRGNKSRKDVNT---------------VKFFGLFFIFYQMAQVWGNLISSSVLTL 237
            ::.:::   |.....:.||.|.               :.|..:|:|.:.::.|:...  .:||.|
Zfish   191 ITRMAQ---QYYEFVNYKDENVQEQKKPPKGAFHSYIIIFQSVFYIIFHLSFVFAEF--PTVLFL 250

  Fly   238 SAPAAQSAANDSFELEVQRELERNRVAEL--CGARFCPGVGAEANPNLVPPAPEQIQLLNSIFLT 300
            :     :..||          .|:.:.::  |||. ..||....|..::...|..:.|:......
Zfish   251 N-----NYLND----------YRHTLFKVSQCGAG-GKGVIENFNKTVLKSLPRSLLLIEVESAL 299

  Fly   301 CMAAAVVMMIF----GVSSLKRYGVKRGDTGDGMSGLKLLTVTINLLRKRRQILMLPITMFIGLE 361
            ..||.:.|:||    |.:......:.....|.|    .:..:....||..|..|:.|..::.|.|
Zfish   300 MGAAFLSMLIFLLLCGAAYRPTEEIDLRSIGWG----NIFQLPFKHLRDYRIRLLCPFFIYSGFE 360

  Fly   362 EAFLAVDFTRSFVACGWGISRIGFAMICFGVANAVAAGIAGALVERIGRVTLAALCAVVNLCLLT 426
            ..|.....|.|:..|..|:.::...::.:|:::::.:.:|.||: |:.|..:....|.|:..|:.
Zfish   361 VLFAVQGLTLSYGVCAVGMEKLWLLVMVYGLSSSICSALALALL-RLPRPVILLAGAFVHFVLII 424

  Fly   427 YMYTWE--AREGDYMSY-CTFAAVWGICDGVWLVVVNAFYGILFPN--HLIAAYSNFRLWESTGS 486
            .:..|.  .|:...:.| ...:|:||:...:....::...|:|:.:  .|...|:.:..|::...
Zfish   425 ALMCWSPTPRDTSRLPYLLVVSALWGLGTALNKTGLSTLLGMLYEDKERLDFVYTIYHWWQAIAI 489

  Fly   487 VIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRFWQK 526
            .|.|:.|: |....||.:|::.:||..:.|..:|.|..:|
Zfish   490 FIVYLWSA-LPMRAKLGLLLLTLLVASLCYVQMERRLAKK 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2121NP_001137618.1 MFS 84..>189 CDD:304372 31/122 (25%)
MFS_1 <296..476 CDD:284993 39/189 (21%)
unc93b1NP_001275745.1 MFS <132..>192 CDD:328737 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335099321
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.