DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: boly and CG8701

Sequence 1:NP_610373.2 Gene:boly FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_610376.1 Gene:CG8701 FlyBaseID:FBgn0033287 Length:246 Species:Drosophila melanogaster

Alignment Length:175 Identity:55/176 (31%)
Similarity:75/176 (43%) Gaps:23/176 (13%)


  Fly    78 RSDPEFNVPAFIDSRKRCLSDRCAMAYPPSDLMFYKPTDKLNRKYQRTWCECELQERKRKAVC-- 140
            :.:..|.....:.....|.:|.||..:||.|..:||.:||..||||.||.||...:.|.|.:|  
  Fly    64 KKEDGFQFHHLVKQPPECCTDPCAERFPPYDQCYYKISDKATRKYQVTWVECPPIKIKPKKICCY 128

  Fly   141 ----RSRPPKIHRRSLRTLPLHPSKV-CSKGNKSLGLGLCRPKPAKSS-CPRFKMPFCKQAITTG 199
                |...|:..|:...|....|:.| |               |.:.. |||.|||.||...:..
  Fly   129 EAGIRPPIPRRKRKKFVTSAECPTNVEC---------------PTEGGPCPRIKMPGCKAVDSVS 178

  Fly   200 CRPGRPPSNCVRPRTKYPSFSECQPYPLPDVPPTHCFCINQPPMC 244
            |...|..::||:.:..|||||||....|.......|.|::.|..|
  Fly   179 CHVVRRKTDCVKVKAPYPSFSECSRSRLRKPRGVECNCLDVPSSC 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bolyNP_610373.2 DM6 94..251 CDD:214775 54/160 (34%)
CG8701NP_610376.1 DUF1431 81..231 CDD:284625 54/159 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131133628
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20977
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.