DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: boly and CG2127

Sequence 1:NP_610373.2 Gene:boly FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_610375.2 Gene:CG2127 FlyBaseID:FBgn0033286 Length:305 Species:Drosophila melanogaster

Alignment Length:223 Identity:69/224 (31%)
Similarity:96/224 (43%) Gaps:50/224 (22%)


  Fly    45 ERKDLKKNDPADNTKVPVKDICWMSMRRSEY--KCRSDPEFNVPAFIDSRKRCLSDRCAMAYPPS 107
            ::|:..|.:.::..|:|.|      ||...|  .|...|:.:||               :.|   
  Fly   105 KKKEEPKKEKSNKPKLPAK------MRSMWYIPDCEYVPKCDVP---------------VRY--- 145

  Fly   108 DLMFYKPTDKLNRKYQRTWCECELQERKRKAVC--RSRP-PKIHRRSLR--------TLPLHPSK 161
            |:..|:.:||..|:||.||.||.....|.|.||  ..|| ||..||..:        |:|:....
  Fly   146 DIQHYRISDKEARQYQVTWNECPRLVIKPKKVCIHAKRPRPKPCRRQRKTVVATARPTMPMLNPM 210

  Fly   162 VCSKGNKSLGLGLCRPKPAKSSCPRFKMPFCKQA-ITTGCRPGRPPSNCVRPRTKYPSFSECQPY 225
            .|.|...|            |.|||:.:|.||.| |...|...|.|::|.:....|||||||:..
  Fly   211 ECKKAEDS------------SPCPRWTLPCCKPARIPPSCHRERRPTDCTKRPAPYPSFSECKRE 263

  Fly   226 PLPDVPPTHCFCINQPPMCVVWNYYRMK 253
            .|.:.|||.|.|:..|..|.:|...|.:
  Fly   264 ELTNAPPTECLCLRVPMACEMWAELRRR 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bolyNP_610373.2 DM6 94..251 CDD:214775 56/169 (33%)
CG2127NP_610375.2 DUF1431 133..290 CDD:284625 61/187 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131133551
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20977
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.