DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: boly and CG4691

Sequence 1:NP_610373.2 Gene:boly FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_609719.1 Gene:CG4691 FlyBaseID:FBgn0028870 Length:262 Species:Drosophila melanogaster

Alignment Length:231 Identity:106/232 (46%)
Similarity:130/232 (56%) Gaps:21/232 (9%)


  Fly    33 DPYEFGAPTMATERKDLKKNDPADNTKVPVKDICWMSMRRSEYKCRSDPEFNVPAFIDSRKRCLS 97
            |.:|.|.|.....|||||..:..|.:|  |.|.||.:.||:||||||||||.:.|||||||.||.
  Fly    41 DGWESGYPAPLLPRKDLKPLEKKDRSK--VYDACWQTTRRTEYKCRSDPEFQMHAFIDSRKSCLE 103

  Fly    98 DRCAMAYPPSDLMFYKPTDKLNRKYQRTWCECELQERKRKAVCRSRPPKIHRRSLRT-LPLHPSK 161
            |.||......||..|||:|...|||.|||.||.::.|||||.|...||.:.||..:: .|..|..
  Fly   104 DPCATEMLAIDLTHYKPSDMGKRKYPRTWFECVVKRRKRKAHCVPVPPPMPRRKRKSKKPRCPED 168

  Fly   162 VCSKGNKSLGLGLCRPKPAKSS-CPRFKMPFCKQAITTGCRPGRPPSNC--------VRPRTKYP 217
            :|..|  .|.|.|.:|...:|| ||||:||.|       |...|.|..|        .||:||||
  Fly   169 LCVLG--KLELNLIKPCVKESSKCPRFRMPNC-------CVAARDPPKCRRPFRRCGQRPKTKYP 224

  Fly   218 SFSECQPYPLPDVPPTHCFCINQPPMCVVWNYYRMK 253
            |||||:..|.||..|..|.|:.:|.:|.:|.:||.:
  Fly   225 SFSECRRDPFPDPRPIECNCLLKPAICDMWRHYRRR 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bolyNP_610373.2 DM6 94..251 CDD:214775 71/167 (43%)
CG4691NP_609719.1 DM6 100..258 CDD:214775 71/167 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131133322
eggNOG 1 0.900 E1_2F9I4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20977
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.