| Sequence 1: | NP_610373.2 | Gene: | boly / 35809 | FlyBaseID: | FBgn0050362 | Length: | 255 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_996281.1 | Gene: | CG33340 / 2768682 | FlyBaseID: | FBgn0053340 | Length: | 229 | Species: | Drosophila melanogaster | 
| Alignment Length: | 250 | Identity: | 73/250 - (29%) | 
|---|---|---|---|
| Similarity: | 98/250 - (39%) | Gaps: | 63/250 - (25%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    31 LFDPYEFGAPTMATE-RKDLKKNDPADNTKVPVKDICWMSMRRSEYKCRSDPEFNVPAFIDSRKR 94 
  Fly    95 -------------CLSDRCAMAYPPS-DLMFYKPTDKLNRKYQRTWCECELQERKRKAVC---RS 142 
  Fly   143 RPPKIHRRSLRTLPLHPSKVCSKGNKSLGLGLCRPKPAKSSCPRF--------KMPFCKQAITTG 199 
  Fly   200 CRPGRPPSNCVRPRTKYPSFSECQPYPLPDVPP-THCFCINQPPMCVVWNYYRMK 253 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| boly | NP_610373.2 | DM6 | 94..251 | CDD:214775 | 57/182 (31%) | 
| CG33340 | NP_996281.1 | DUF1431 | 73..223 | CDD:284625 | 56/169 (33%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45451828 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0005300 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR20977 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.030 | |||||