DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: boly and hubl

Sequence 1:NP_610373.2 Gene:boly FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001286194.1 Gene:hubl FlyBaseID:FBgn0050364 Length:291 Species:Drosophila melanogaster

Alignment Length:286 Identity:81/287 (28%)
Similarity:115/287 (40%) Gaps:68/287 (24%)


  Fly     6 NTLSRAPVAIRSGL----TSRTIQV-----RMESLFDPYEFGAPTMATERKDLK--KNDPADNTK 59
            |:|::..|.:.|.:    |.|||.|     ||...|.|        .:|..|.|  |..|...|.
  Fly     3 NSLAKRIVLMPSLIALEDTCRTIHVTALMARMGKDFCP--------VSEVPDCKVVKKRPCSPTD 59

  Fly    60 VPVKDICWMSMRRSEYKC----------RSDPEFNVPAFIDSRKRCLSD-----RCAMAYPPS-- 107
            .||:........:..|.|          .:||. ....|:...||...|     .....||..  
  Fly    60 PPVRPCSEEGCTQPRYSCCVSTGISANPCADPS-KKTKFVSMWKRYKDDGSNRPEAMWHYPEECC 123

  Fly   108 --------DLMFYKPTDKLNRKYQRTWCEC--ELQERKRKAVCRSRPPKIHRRSLRTLPLHPSKV 162
                    |:::|.|:||. |::||||.||  ::..::....|.:.||::.||.   ||:.|...
  Fly   124 PKCEDTRFDVLYYTPSDKC-REFQRTWWECCPKMVPKRVCCWCDAIPPEVLRRD---LPICPRSA 184

  Fly   163 C-----SKGNKSLGLGLCRPKPAKSSCPRFKMPFCKQA-ITTGCRPGRPPSNCVRPRTKYPSFSE 221
            |     .|..|      |..|..| .|.|.:||.|:.| |...||....||:|.:.:..:||:||
  Fly   185 CLAEHERKRYK------CLNKRYK-GCMRIRMPCCRTARIPPDCRAFPGPSDCEKIKCPFPSYSE 242

  Fly   222 C---QPYPLPDVPPTHCFCINQPPMC 244
            |   .|..:|..|| .|.|:.:...|
  Fly   243 CVQEDPAVIPTRPP-ECECLKKASQC 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bolyNP_610373.2 DM6 94..251 CDD:214775 54/178 (30%)
hublNP_001286194.1 DUF1431 126..275 CDD:284625 50/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131133406
eggNOG 1 0.900 E1_2F9I4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20977
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.