DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11635 and CG2127

Sequence 1:NP_610372.1 Gene:CG11635 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_610375.2 Gene:CG2127 FlyBaseID:FBgn0033286 Length:305 Species:Drosophila melanogaster

Alignment Length:269 Identity:80/270 (30%)
Similarity:112/270 (41%) Gaps:63/270 (23%)


  Fly     4 SSLLRGFSSRQSGSSNKPPKPPSPPKPPSSPSPPKSPSAKRECKIRTHCIPAAF------CAEGD 62
            ||:||....|::.||.........||.....|..|.            |.||.|      ..:|.
  Fly    50 SSVLRQHLLRRNYSSQSSADDCGRPKDCDQVSTSKG------------CGPARFKGTICDAVKGG 102

  Fly    63 KFKSMWDP--PKNLPPPYPFVVSRSNDLC----CE--PNCTKPLPSFDELYYRPSCKNG-PYQRH 118
            |.|...:|  .|:..|..|   ::...:.    ||  |.|..|: .:|..:||.|.|.. .||..
  Fly   103 KRKKKEEPKKEKSNKPKLP---AKMRSMWYIPDCEYVPKCDVPV-RYDIQHYRISDKEARQYQVT 163

  Fly   119 WVECPKFMIRKKIICAYDKLEALSPARRVAERRERTTLSATA-----------------TGPCPH 166
            |.|||:.:|:.|.:|.:.|.....|.     ||:|.|:.|||                 :.|||.
  Fly   164 WNECPRLVIKPKKVCIHAKRPRPKPC-----RRQRKTVVATARPTMPMLNPMECKKAEDSSPCPR 223

  Fly   167 FAPLARCVPGRRPPRCHAAKTPSCCRRLCAPMPCWSDCKQPKLAKRPYRPRECEC-RFPLSLCEA 230
            :. |..|.|.|.||.||..:.|:.|.:..||.|.:|:||:.:|...|  |.||.| |.|:: || 
  Fly   224 WT-LPCCKPARIPPSCHRERRPTDCTKRPAPYPSFSECKREELTNAP--PTECLCLRVPMA-CE- 283

  Fly   231 ERGRQWVKI 239
                .|.::
  Fly   284 ----MWAEL 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11635NP_610372.1 DM6 88..235 CDD:214775 57/172 (33%)
CG2127NP_610375.2 DUF1431 133..290 CDD:284625 58/172 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131133812
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20977
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.