DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11635 and boly

Sequence 1:NP_610372.1 Gene:CG11635 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_610373.2 Gene:boly FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster

Alignment Length:180 Identity:48/181 (27%)
Similarity:70/181 (39%) Gaps:37/181 (20%)


  Fly    63 KFKSMWDPPKNLPPPYPFVVSRSNDLCCEPNCTKPLPSFDELYYRPSCK-NGPYQRHWVECPKFM 126
            ::|...||..|:|   .|:.||..  |....|....|..|.::|:|:.| |..|||.|.||....
  Fly    74 EYKCRSDPEFNVP---AFIDSRKR--CLSDRCAMAYPPSDLMFYKPTDKLNRKYQRTWCECELQE 133

  Fly   127 IRKKIICAY--DKLE-------ALSPARRVAERRERTTLSATATGP----CPHF-APLAR----- 172
            .::|.:|..  .|:.       .|.|::..::..:...|......|    ||.| .|..:     
  Fly   134 RKRKAVCRSRPPKIHRRSLRTLPLHPSKVCSKGNKSLGLGLCRPKPAKSSCPRFKMPFCKQAITT 198

  Fly   173 -CVPGRRPPRCHAAKTPSCCRRLCAPMPCWSDCKQPKLAKRPYRPRECEC 221
             |.|||.|..|...:|         ..|.:|:|:...|...|  |..|.|
  Fly   199 GCRPGRPPSNCVRPRT---------KYPSFSECQPYPLPDVP--PTHCFC 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11635NP_610372.1 DM6 88..235 CDD:214775 40/156 (26%)
bolyNP_610373.2 DM6 94..251 CDD:214775 40/158 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131134049
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20977
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.