DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11635 and CG33340

Sequence 1:NP_610372.1 Gene:CG11635 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_996281.1 Gene:CG33340 FlyBaseID:FBgn0053340 Length:229 Species:Drosophila melanogaster

Alignment Length:234 Identity:68/235 (29%)
Similarity:88/235 (37%) Gaps:63/235 (27%)


  Fly    15 SGSSNK-PPKPPS-----PPKPPSSPSPPKSPSAKRECKIRTHCIPAAFCAEGDKFKSMW----- 68
            ||...| |.:.|.     |...|:..:|||.   ||:..               |.:|||     
  Fly    27 SGCEKKGPSRCPKVLTKFPCGKPNLQAPPKK---KRKMV---------------KAQSMWLNPFC 73

  Fly    69 DPPKNLPPPYPFVVSRSNDLCCEPNCTKPLPSFDELYYRPSCK-NGPYQRHWVECPKFMIRKKII 132
            ||               :|..|..|     |.||::||..|.| ...|.:.||.||...|:.|.|
  Fly    74 DP---------------DDTACPFN-----PRFDDIYYVESDKAKRKYWQTWVACPPIQIKPKKI 118

  Fly   133 CAYDKLEALSPARRVAERRERTTLSATATGP----CPHFAPLARC-VPGRRPPRCHAAKTPSCCR 192
            |.:.|.:.....||....:..|........|    ||..|  .|| ..|||||.|...:.|..|.
  Fly   119 CCFAKAKPAPIKRRKPSAKPSTACPQPCPDPSEDLCPRLA--RRCHRDGRRPPSCRRERGPLPCV 181

  Fly   193 RLCAPMPCWSDCKQPKLAKRPYRP--RECECRFPLSLCE 229
            :...|.|.:|:|::.|    |..|  :||.|.....|||
  Fly   182 KPRTPYPSFSECRRLK----PDAPPLKECNCLAKPLLCE 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11635NP_610372.1 DM6 88..235 CDD:214775 49/151 (32%)
CG33340NP_996281.1 DUF1431 73..223 CDD:284625 52/171 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131134274
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20977
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.