DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14760 and CG11668

Sequence 1:NP_610366.1 Gene:CG14760 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster

Alignment Length:285 Identity:84/286 (29%)
Similarity:128/286 (45%) Gaps:62/286 (22%)


  Fly   251 GGRFSCLVEAFQP-TCSCGWSRIPRIASPTNEEAVLHEFPPMAGVLTKKHGKVFCGAAIIHHRYL 314
            |||.:  .|...| .|:.||        |:.....:||...     :|:.....||.|:|..|:.
  Fly   150 GGRLT--QENEHPYMCALGW--------PSRTNRWIHEHGS-----SKRRYTFNCGCAMIAPRFA 199

  Fly   315 LSAAHC-FLGPETNSAAKLRVVVGEHDLASSFETFATQRYDLDALILHEDFSQASGQPKNDIAML 378
            ::|||| .:|.|:.|.|    ::|..:|.|.    ..|..::..:..|..|...:  ..||:|::
  Fly   200 ITAAHCASVGGESPSVA----LIGGVELNSG----RGQLIEIKRISQHPHFDAET--LTNDLAVV 254

  Fly   379 KTR------MAIVWSQHVGPACLPLQPGEDGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLD 437
            |..      :|.:|:|.    .||.:|             :.|.|:|.|.:.||.:..||:..|.
  Fly   255 KLARRSHMPVACLWNQE----SLPERP-------------LTALGYGQTKFAGPHSSNLLQIMLY 302

  Fly   438 VIDGRRCRQALSS----AGGLPPHTFCT--YTPGRDTCQYDSGGALYERINGR------LMAVGI 490
            .::.::|::.|.:    |.||.....|.  |:...||||.||||.|....:.|      ...|||
  Fly   303 HLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGI 367

  Fly   491 VSFGQACAAQQPSVNTRVASFIKWI 515
            .|||.|||:.||.|..|:|.:|:||
  Fly   368 TSFGGACASGQPGVYVRIAHYIQWI 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 75/255 (29%)
Tryp_SPc 281..515 CDD:214473 74/253 (29%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 84/286 (29%)
Tryp_SPc 149..392 CDD:214473 83/284 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47779
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.