DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LRP1 and arr

Sequence 1:NP_001260800.2 Gene:LRP1 FlyBaseID:FBgn0053087 Length:4752 Species:Drosophila melanogaster
Sequence 2:NP_524737.2 Gene:arr FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster

Alignment Length:1698 Identity:464/1699 (27%)
Similarity:728/1699 (43%) Gaps:317/1699 (19%)


  Fly  1251 FSKQCVTVDQLCDGKNDCEDTTDEGFLCADKLCDRGHECSHRCHNTPEGY---------ICSCPD 1306
            ::|......|||...::.||.|.:...|...             |:..|:         ||.   
  Fly     6 YTKSAEIEPQLCQVIDNNEDVTTKATKCTKS-------------NSGVGWRQMLIGFLLICF--- 54

  Fly  1307 HLYLQPNGKRCSMQHACDHWDTCSQVCESSGKGYDCRCLDGFDLGFDRFTCKSTAPDEPYV---- 1367
                   |...|.|:...|..:.|.:..|                         .|...:|    
  Fly    55 -------GISNSWQYKNVHMPSSSSLIAS-------------------------PPASAFVNTPA 87

  Fly  1368 --IFTNRQDIKGINLKTLNVGN-----FYSSLRNIIALDFLYNNESNVEIYWTDVIDDKIYRGHL 1425
              :||.|.||:..|: |...|.     ....|...:|:||.|  ..|: :.|||...:.|.....
  Fly    88 TLLFTTRHDIQVANI-TRPTGGPQIDVIVRDLAEAMAIDFYY--AKNL-VCWTDSGREIIECAQT 148

  Fly  1426 VGESLRNV-----EAVIHSGLSTTEGLAVDWVGKNLYWIDSNLDQIEVAKLNGSFRRTLIAGNME 1485
            ...:|:.:     :.||.:||...||||:||....:||.|...::||||.|:|.:::.|...:::
  Fly   149 NSSALQPLLRAPKQTVISTGLDKPEGLAMDWYTDKIYWTDGEKNRIEVATLDGRYQKVLFWTDLD 213

  Fly  1486 SPRAIALDPREGLLFWTDWDDNSPRIERASMSGDG-RRMISTSWQLSAGWPNGLTLDYTQKRVYW 1549
            .|||:|:.|...||.||||.: .|:||||||.||. .||  |..:....|||||.:|...:.:||
  Fly   214 QPRAVAVVPARKLLIWTDWGE-YPKIERASMDGDPLSRM--TLVKEHVFWPNGLAVDLKNELIYW 275

  Fly  1550 VDAKSDSISSTMYDGSEHHVVLRNKEILSHPFAISVFENYVYWTDWRTTSVIRANKWNGSDVQV- 1613
            .|.|...|.....|||....::.|   |.:||:::.:::.:|||||:..|:      |..|:|. 
  Fly   276 TDGKHHFIDVMRLDGSSRRTIVNN---LKYPFSLTFYDDRLYWTDWQRGSL------NALDLQTR 331

  Fly  1614 ----LQRTQSQPFGIQVLHSSRQPWDRNPCGENNGGCSHLCLLSGRGT-FKCECPHVMRLDPANE 1673
                |..|...|..::....|.||::.|||..|||.|||||||:.... |.|.||..::|..|| 
  Fly   332 ELKELIDTPKAPNSVRAWDPSLQPYEDNPCAHNNGNCSHLCLLATNSQGFSCACPTGVKLISAN- 395

  Fly  1674 RNCVPNEQVLLFVMV-DEIRGIDLHQPNHHTIP-TIRQSPRLVAPQRIDFLVDESRIFWSDIQQN 1736
             .|....|.::|::. .:|..|.|..|::...| .:.:....:|   ||:...|..|:|||::..
  Fly   396 -TCANGSQEMMFIVQRTQISKISLDSPDYTIFPLPLGKVKYAIA---IDYDPVEEHIYWSDVETY 456

  Fly  1737 EISSAGISNGLIEPIINTNIEKPYGFAVDWIARNMYFSSGQIKCNILASNLKGEFASI-IHEDLN 1800
            .|..|......:...:.:.:..|.|.|:||:|||:|::. .:...|....|.|....: |:|.|.
  Fly   457 TIKRAHADGTGVTDFVTSEVRHPDGLALDWLARNLYWTD-TVTDRIEVCRLDGTARKVLIYEHLE 520

  Fly  1801 MVDSIVLDPANGKMYWIHSASDGS--MSQLEQSNLDGSSRSLIYQHENNL---QSLTMDFDSQRL 1860
            ...:|.:.|:.|.|:|    ||.:  ..::|:::||||.|.::.  ..||   ..:.:|.:::.:
  Fly   521 EPRAIAVAPSLGWMFW----SDWNERKPKVERASLDGSERVVLV--SENLGWPNGIALDIEAKAI 579

  Fly  1861 YYA---YDNSGIAYYDIPRNETRKVLVASPITSISSLTVYNGTLYFPENIQSVIMQCEKEACSNM 1922
            |:.   .|...:|..|   ...|:|:::..:..:..|::.:..||:.:..:..|.:..|...:|.
  Fly   580 YWCDGKTDKIEVANMD---GSGRRVVISDNLKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNR 641

  Fly  1923 SYLRVNTKSIQSMKMFYADAQTGSNTCAEWAYRGGCQQLCLATSSIDHVCRCALGYDVEPNNPTG 1987
            ..:......:..:|:.......|.|.||  ...|||..||| ....|:|||||:.|:: .|:...
  Fly   642 IVVVDQYPDLMGLKVTRLREVRGQNACA--VRNGGCSHLCL-NRPRDYVCRCAIDYEL-ANDKRT 702

  Fly  1988 CVPRAEFIFYSIDVLQGVEMIDPSEQFDTPSPALVPISRVSSASFIDYLANTDTLYWGDNELGSI 2052
            ||..|.|:.:|.....|...|:.:|  ...:...:|...|..|..:|.......:||.|.:...|
  Fly   703 CVVPAAFLLFSRQEHIGRISIEYNE--GNHNDERIPFKDVRDAHALDVSVAERRIYWTDQKSKCI 765

  Fly  2053 SRVKRDGTQRETILEALNLVGYKQQDWLGGIAIDWVAGNIYWSDTKRNIIEVARLDGSHRYVVV- 2116
            .|...:|:..:.|::: .|:|      ..|||:||:|.||||||.:...|||||||||.|.|:: 
  Fly   766 FRAFLNGSYVQRIVDS-GLIG------PDGIAVDWLANNIYWSDAEARRIEVARLDGSSRRVLLW 823

  Fly  2117 SNLEKPTALAVDPLQGLLFYVTQ--QHIGRVGLDGSQPFVLVNQTRANWAVGSLVLDIEATKVYW 2179
            ..:|:|.:|.::|.:|.:::...  ..|.|..:|||....:|  ..||.|.| |..|.|..::||
  Fly   824 KGVEEPRSLVLEPRRGYMYWTESPTDSIRRAAMDGSDLQTIV--AGANHAAG-LTFDQETRRLYW 885

  Fly  2180 C-ERYPDALMKVDYDGNLREQLLNESLNNPVALAKMGDYLYWAENKYNEG-IIRVAPLANLSQSK 2242
            . :..|..:...|:||..|:.|:...::.|.|::...||:||::  :|.| |.||.  ....|::
  Fly   886 ATQSRPAKIESADWDGKKRQILVGSDMDEPYAVSLYQDYVYWSD--WNTGDIERVH--KTTGQNR 946

  Fly  2243 VVLQTEQDAIRDLKIYSKHLQRGSNPCAHSNGACEQLCLF--NGTSAVCAC-AHSRLASDGYSCE 2304
            .::.:....|..|.:::...|.|.|||..:||.|..|||.  ......||| .|.:||.||.||.
  Fly   947 SLVHSGMTYITSLLVFNDKRQTGVNPCKVNNGGCSHLCLAQPGRRGMTCACPTHYQLAKDGVSCI 1011

  Fly  2305 PYENFLLFSYRSNIESI--HMTDHADKNWPVQMISNTSLMRNVIAITYNYEEQLVYYSDVQLSTI 2367
            |..|:::||.|:....:  :.||..:...||.       .:|:.|:.|:.....:|:.:.:..:|
  Fly  1012 PPRNYIIFSQRNCFGRLLPNTTDCPNIPLPVS-------GKNIRAVDYDPITHHIYWIEGRSHSI 1069

  Fly  2368 NQVHFNGTGHRVLLEQQQRVEGLAYDIVNEQLFWTSNNNATIRSVELRHLSEHADQNQVHVKKVL 2432
            .:...|||...:|....|..: ||.||:...||||.:.:.:|.....  |.|...        |:
  Fly  1070 KRSLANGTKVSLLANSGQPFD-LAIDIIGRLLFWTCSQSNSINVTSF--LGESVG--------VI 1123

  Fly  2433 SLREDDKPRGIAVEPCLGMIYWTNWNEGS-PCIQRSYLTGYGTEVIIKTDIKMPNALTLDLEQQK 2496
            ...:.:|||.|||.....:::||  :.|| ..|.|:.:.| ...|.:...::...||.||.:...
  Fly  1124 DTGDSEKPRNIAVHAMKRLLFWT--DVGSHQAIIRARVDG-NERVELAYKLEGVTALALDQQSDM 1185

  Fly  2497 LYWADARLDKIERTNYDGSNRVVLAHSTPKHAFAMAVYGDLLFWTDWVLHAVVRANKYTGTDVLF 2561
            :|:|..:  :|:..:.:|.|:..|..........:|..|..::|.|          ..||     
  Fly  1186 IYYAHGK--RIDAIDINGKNKKTLVSMHISQVINIAALGGFVYWLD----------DKTG----- 1233

  Fly  2562 LREHVTRPMGIVAVQNTSINCDANQCKILN-GQCEDVCILNKSGQATCHCTQGVLAPDGRRCIAP 2625
                         |:..::|.:....::.. .|..|:              :.|..||.:   ..
  Fly  1234 -------------VERITVNGERRSAELQRLPQITDI--------------RAVWTPDPK---VL 1268

  Fly  2626 VNTSCGLSQYNCHSGECIPLELTCDNVTHCADGSDEFRSYCIFRQCPETHFMCQNHRCIPKEHKC 2690
            .|.:|..|:..| |..||.          ..:|....|..|   .||: |.|     .:..:..|
  Fly  1269 RNHTCMHSRTKC-SHICIA----------SGEGIARTRDVC---SCPK-HLM-----LLEDKENC 1313

  Fly  2691 DGEQQCGDGSDETPLLCKCQSEDIDMHPSNNNTKEMPDMFRCGSGECIPRKFLCDSLKDCRDFSD 2755
            .....||                             ||.|.|.:    |...:.|..|||     
  Fly  1314 GAFPACG-----------------------------PDHFTCAA----PVSGISDVNKDC----- 1340

  Fly  2756 EKMCAPIPCEKNDMTFVHCGNSTICIMPRWRCDGDPDCPDGTDELDCANHTSLSCDPGQFRCASG 2820
                  ||..                   |||||..||||.:||:.|.     :|...||.|.||
  Fly  1341 ------IPAS-------------------WRCDGQKDCPDKSDEVGCP-----TCRADQFSCQSG 1375

  Fly  2821 NCIAGSWHCDGEKDCPDGSDEINCRTEC-RHNQFAC--DKTCIPASWQCDGKSDCEDGSDEGPQ- 2881
            .||..|..|||..:|.:|.||.:|   | |..:|.|  :|.||.|:..|||..:|.||:||... 
  Fly  1376 ECIDKSLVCDGTTNCANGHDEADC---CKRPGEFQCPINKLCISAALLCDGWENCADGADESSDI 1437

  Fly  2882 CPNRPCRP 2889
            |..|...|
  Fly  1438 CLQRRMAP 1445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LRP1NP_001260800.2 LDLa 87..118 CDD:197566
LDLa 126..163 CDD:238060
EGF_CA 246..283 CDD:214542
Ldl_recept_b 449..487 CDD:278487
LY 472..513 CDD:214531
LY 817..852 CDD:214531
LDLa 1057..1092 CDD:197566
LDLa 1104..1134 CDD:238060
FXa_inhibition 1289..1317 CDD:291342 5/37 (14%)
LY 1434..1476 CDD:214531 19/42 (45%)
LY 1477..1521 CDD:214531 21/45 (47%)
LY 1533..1567 CDD:214531 14/34 (41%)
LY 1568..1611 CDD:214531 12/43 (28%)
FXa_inhibition 1639..1676 CDD:291342 18/38 (47%)
LY 1794..1838 CDD:214531 15/47 (32%)
LY 2078..2112 CDD:214531 21/34 (62%)
NHL <2082..>2152 CDD:302697 33/73 (45%)
NHL repeat 2082..2120 CDD:271320 23/39 (59%)
FXa_inhibition 2269..2303 CDD:291342 16/37 (43%)
LY 2430..2471 CDD:214531 13/42 (31%)
LY 2475..2517 CDD:214531 10/42 (24%)
LDLa 2630..2661 CDD:238060 7/31 (23%)
LDLa 2671..2702 CDD:238060 7/31 (23%)
LDLa 2727..2759 CDD:238060 9/32 (28%)
LDLa 2773..2802 CDD:238060 11/29 (38%)
LDLa 2810..2844 CDD:238060 16/34 (47%)
LDLa 2848..2878 CDD:238060 15/33 (45%)
LDLa 2887..2916 CDD:197566 1/4 (25%)
LDLa 2938..2969 CDD:197566
LDLa 2989..3015 CDD:197566
LDLa 3030..3061 CDD:238060
EGF_CA 3062..>3091 CDD:214542
EGF_CA 3103..3141 CDD:214542
LY 3212..3254 CDD:214531
LY 3255..3297 CDD:214531
LY 3299..3340 CDD:214531
LY 3354..3389 CDD:214531
LDLa 3458..3490 CDD:238060
LDLa 3499..3533 CDD:238060
LDLa 3582..3616 CDD:238060
LDLa 3621..3652 CDD:197566
LDLa 3663..3697 CDD:238060
LDLa 3702..3736 CDD:238060
LDLa 3776..3808 CDD:197566
LDLa 3818..3849 CDD:197566
LDLa 3860..3894 CDD:238060
NHL 4029..>4158 CDD:302697
NHL repeat 4034..4074 CDD:271320
NHL repeat 4076..4115 CDD:271320
LY 4108..4150 CDD:214531
NHL repeat 4121..4158 CDD:271320
EGF_CA <4386..4414 CDD:238011
EGF_CA 4415..4450 CDD:238011
arrNP_524737.2 LY 162..201 CDD:214531 18/39 (46%)
NHL 168..503 CDD:302697 122/353 (35%)
NHL repeat 172..237 CDD:271320 28/66 (42%)
LY 252..293 CDD:214531 15/41 (37%)
NHL repeat 261..298 CDD:271320 13/37 (35%)
NHL repeat 303..339 CDD:271320 12/42 (29%)
NHL repeat 341..419 CDD:271320 30/80 (38%)
NHL repeat 428..476 CDD:271320 10/51 (20%)
LY 472..511 CDD:214531 12/40 (30%)
NHL repeat 477..503 CDD:271320 10/27 (37%)
Ldl_recept_b 534..573 CDD:278487 12/45 (27%)
LY 558..599 CDD:214531 7/46 (15%)
LY 600..641 CDD:214531 7/41 (17%)
FXa_inhibition 668..703 CDD:291342 16/39 (41%)
LY 739..773 CDD:214531 9/34 (26%)
LY 776..818 CDD:214531 24/49 (49%)
LY 819..860 CDD:214531 11/41 (27%)
FXa_inhibition 973..1010 CDD:291342 16/37 (43%)
LY 1122..1164 CDD:214531 14/45 (31%)
FXa_inhibition 1273..1313 CDD:291342 13/60 (22%)
LDLa 1319..1362 CDD:238060 24/106 (23%)
LDLa 1365..1399 CDD:238060 16/34 (47%)
LDLa 1399..1433 CDD:197566 16/37 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102663510
eggNOG 1 0.900 E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126933
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.730

Return to query results.
Submit another query.