DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pabp2 and PABPN1L

Sequence 1:NP_476902.1 Gene:Pabp2 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001073956.2 Gene:PABPN1L HGNCID:37237 Length:278 Species:Homo sapiens

Alignment Length:237 Identity:106/238 (45%)
Similarity:141/238 (59%) Gaps:35/238 (15%)


  Fly    15 ESLEETNGEQETE-----IATEVEEEGSMQI---DPELEAIKARVKEMEEEAEKIK-----QMQS 66
            |..||.:.|::.:     :.:.:|:|...:.   |.||||||.:|..| |:||...     |.|:
Human    50 EKEEEEDAEEDQDGDAGFLLSLLEQENLAECPLPDQELEAIKMKVCAM-EQAEGTPRPPGVQQQA 113

  Fly    67 EVDKQMAGGSTTGLATV--PLS--LEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTI 127
            |.::..|.|......||  |||  .|||.|.|.|||||||||||.|||||||||..||.::||||
Human   114 EEEEGTAAGQLLSPETVGCPLSGTPEEKVEADHRSVYVGNVDYGGSAEELEAHFSRCGEVHRVTI 178

  Fly   128 LCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTNRFARGSFRG- 191
            ||:|..|||||:|||||.:|..|:.|:.::::|||||.|||:.||||.||:|:|:   ||..|| 
Human   179 LCDKFSGHPKGYAYIEFATKGSVQAAVELDQSLFRGRVIKVLPKRTNFPGISSTD---RGGLRGH 240

  Fly   192 ---RGARVSRACCHSTFRGARRAMGY-----RGR-ANYYAPY 224
               |||...    ||..:|..|....     ||: :.:::||
Human   241 PGSRGAPFP----HSGLQGRPRLRPQGQNRARGKFSPWFSPY 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 77/138 (56%)
RRM_II_PABPN1 97..172 CDD:240994 50/75 (67%)
PABPN1LNP_001073956.2 RRM <138..>231 CDD:223796 62/93 (67%)
RRM_II_PABPN1L 148..224 CDD:240995 51/76 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1412946at2759
OrthoFinder 1 1.000 FOG0000982
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23236
Phylome 1 0.910 0.725 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.