DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pabp2 and Rnps1

Sequence 1:NP_476902.1 Gene:Pabp2 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001011890.1 Gene:Rnps1 RGDID:1307522 Length:305 Species:Rattus norvegicus

Alignment Length:58 Identity:15/59 (25%)
Similarity:28/59 (47%) Gaps:1/59 (2%)


  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGH-PKGFAYIEFGSKEFVETAL 154
            |::|.:....:.:.:...|...|.|..:.:...:...| .||:||:||.:.:..|.||
  Rat   163 VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKAL 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 15/59 (25%)
RRM_II_PABPN1 97..172 CDD:240994 15/59 (25%)
Rnps1NP_001011890.1 Necessary for interaction with the cleaved p110 isoform of CDC2L1. {ECO:0000250} 1..220 14/57 (25%)
Necessary for interaction with SRP54, nuclear localization and exon-skipping. {ECO:0000250} 1..161
Necessary for interactions with UPF2 and UPF3B and UPF2-dependent NMD. {ECO:0000250} 69..121
Necessary for interaction with PNN and exon-skipping. {ECO:0000250} 156..242 15/59 (25%)
Interaction with SAP18 and ACIN1. {ECO:0000250} 159..244 15/59 (25%)
RRM_RNPS1 163..236 CDD:240811 15/59 (25%)
Necessary for interaction with TRA2B, nuclear localization and exon-skipping. {ECO:0000250} 238..305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.