DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and SLA2

DIOPT Version :8

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_016883587.1 Gene:SLA2 / 84174 HGNCID:17329 Length:288 Species:Homo sapiens

Alignment Length:81 Identity:22/82 (27%)
Similarity:40/82 (49%) Gaps:9/82 (11%)


  Fly   189 WYWGEISRRDSQR--QLSDKPTGSFLVRDSETSGSQFTLSFRIVNVT-----LHYRLEYRDNFWH 246
            |.:..:||..::.  .|...|.|:||:|:|:|....::||.|:....     .|||:...||.|.
Human    94 WLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWL 158

  Fly   247 F--EELKYESIVEMIE 260
            :  ..|.:.|:..:::
Human   159 YISPRLTFPSLQALVD 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 22/82 (27%)
SOCS 293..333 CDD:295349
SLA2XP_016883587.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10155
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.