DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12769 and MET31

Sequence 1:NP_001286181.1 Gene:CG12769 FlyBaseID:FBgn0033252 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_015287.1 Gene:MET31 SGDID:S000005959 Length:177 Species:Saccharomyces cerevisiae

Alignment Length:134 Identity:41/135 (30%)
Similarity:60/135 (44%) Gaps:28/135 (21%)


  Fly   102 LLHVVQCLAGQAAAAAAAAAASAR-LKSEDLQEPENMSLGHMEGGKGDGQTGNGSSSSASSSPAG 165
            |||.::    |::..:|...|... ||:   .|||||:.|.:.                  .|..
Yeast    38 LLHRIR----QSSPLSAVIPAPENVLKA---GEPENMARGLIR------------------IPET 77

  Fly   166 NSGGGGGGNSSSR--KVFECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHF 228
            .:...||.|.|..  :::.|..|.:|||..:::|||:..|:.|.|:.|..|.|.|.|||.|..|.
Yeast    78 QTKRTGGNNHSKEGAQLYSCAKCQLKFSRSSDLRRHEKVHSLVLPHICSNCGKGFARKDALKRHS 142

  Fly   229 TTHT 232
            .|.|
Yeast   143 NTLT 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12769NP_001286181.1 C2H2 Zn finger 183..203 CDD:275368 8/20 (40%)
zf-H2C2_2 195..218 CDD:290200 9/23 (39%)
C2H2 Zn finger 211..231 CDD:275368 10/20 (50%)
C2H2 Zn finger 239..255 CDD:275368
C2H2 Zn finger 662..689 CDD:275371
C2H2 Zn finger 690..712 CDD:275371
MET31NP_015287.1 COG5048 <75..>166 CDD:227381 27/73 (37%)
zf-C2H2 95..117 CDD:278523 8/22 (36%)
C2H2 Zn finger 97..117 CDD:275368 8/20 (40%)
zf-H2C2_2 109..134 CDD:290200 10/25 (40%)
C2H2 Zn finger 125..144 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3390
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.