DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12769 and TRPS1

Sequence 1:NP_001286181.1 Gene:CG12769 FlyBaseID:FBgn0033252 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_054831.2 Gene:TRPS1 HGNCID:12340 Length:1294 Species:Homo sapiens

Alignment Length:1035 Identity:187/1036 (18%)
Similarity:292/1036 (28%) Gaps:396/1036 (38%)


  Fly    41 HNAMALRSLKD---AASSASESELQEPRSPTPTPTN-------------LSTGPHSPPMT----- 84
            ||.:.....||   ...|.....||:..|..|...|             :..|..:|...     
Human   281 HNMVQFSHSKDFQKVNRSVFSGVLQDINSSRPVLLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKY 345

  Fly    85 FRCERCD-SFETSSRASLLLHVVQCLAGQAAA---AAAAAAASARLKSED---LQEPENMSLGH- 141
            |||:.|: ::..:|...|..|.:|....:..|   ::..|..|.:..::.   ||..::..||. 
Human   346 FRCKFCNFTYMGNSSTELEQHFLQTHPNKIKASLPSSEVAKPSEKNSNKSIPALQSSDSGDLGKW 410

  Fly   142 -----MEGGKG------------DGQTGNGS-----------SSSASSSPA-------GNSGG-- 169
                 ::.|..            |....||:           |.|..||.:       |...|  
Human   411 QDKITVKAGDDTPVGYSVPIKPLDSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYGKQHGAV 475

  Fly   170 --GGGGNSSSRKVFECDVCNM----KFSNGANMRRHKMRHTGVK---------------PYECRV 213
              ||.....:.|:....|.|.    |.|.|..|.:.....:|.|               .|.|:.
Human   476 QSGGLNPELNDKLSRGSVINQNDLAKSSEGETMTKTDKSSSGAKKKDFSSKGAEDNMVTSYNCQF 540

  Fly   214 CQKRFFRKDH---------LAEHF----TTHTKTLPYHCPICNRGF---QRQIA----------- 251
            |..| :.|.|         |..|:    ..|..|:. |||.|.||.   ::.:.           
Human   541 CDFR-YSKSHGPDVIVVGPLLRHYQQLHNIHKCTIK-HCPFCPRGLCSPEKHLGEITYPFACRKS 603

  Fly   252 -------MRAHFQNEHVGQHDLVKTCPLCSYRAGSMKSLRIHFFNRHGIDLDN--------PGPG 301
                   :..|......|...:...|..||:....:..|..|:.:.|.....:        .|..
Human   604 NCSHCALLLLHLSPGAAGSSRVKHQCHQCSFTTPDVDVLLFHYESVHESQASDVKQEANHLQGSD 668

  Fly   302 GTSSL-------------LLALESQASAAAAAAAASYVPPGLSPVPVQSQSQQQ-------QQQQ 346
            |..|:             :..:|.:.|.....|.:.|.....|.....:||..:       |:|.
Human   669 GQQSVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAADTQSLLEHFNTVHCQEQD 733

  Fly   347 VA----------------------------PPASDSGE--------------------------S 357
            :.                            .|.|..||                          |
Human   734 ITTANGEEDGHAISTIKEEPKIDFRVYNLLTPDSKMGEPVSESVVKREKLEEKDGLKEKVWTESS 798

  Fly   358 MRSLENAT---------------PPMHFLTP----HVEISTLGESGNTELFNL------ICVWRE 397
            ...|.|.|               ..:..|||    ..:..||.:|.|.|..:|      :.|..:
Human   799 SDDLRNVTWRGADILRGSPSYTQASLGLLTPVSGTQEQTKTLRDSPNVEAAHLARPIYGLAVETK 863

  Fly   398 SALQG--------------------NNNNNNNN--------------NCATNNNN----NING-- 422
            ..|||                    |.:.:.:.              ||.|...:    |.||  
Human   864 GFLQGAPAGGEKSGALPQQYPASGENKSKDESQSLLRRRRGSGVFCANCLTTKTSLWRKNANGGY 928

  Fly   423 ASNNCNSIS---------NGNAESNGDKVKDRALIMQSPVELPMDCNTKATPITSSTTASSLSGG 478
            ..|.|....         |...::||:::..|              .|:......:..|..|:..
Human   929 VCNACGLYQKLHSTPRPLNIIKQNNGEQIIRR--------------RTRKRLNPEALQAEQLNKQ 979

  Fly   479 LKSHHQHPHHHHHHHHHHENHIT---------PSISLIPIK---------QEP--MSEDMDKKDL 523
            .:..::...:........|:|:|         ||:|....:         |:|  :|:.:|....
Human   980 QRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQTLDIHKR 1044

  Fly   524 MNGSDP-----SSDTEQASNNNNSSSNNNRITSLIKVSPLKSLLREDLKRRICAKANNRITRNAT 583
            |   .|     .|..|...:..||||.:....|..:.||::..:|.       ||..| .:...:
Human  1045 M---QPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSPIEKYMRP-------AKHPN-YSPPGS 1098

  Fly   584 PLE--------------------------SNNNNSVLSNS--LSNGSGRGSPGVN---------- 610
            |:|                          |....||..|.  ||:..|..:|..|          
Human  1099 PIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQNYVPYPTFNLP 1163

  Fly   611 ----------------------GGSGGGGGGGPPTPATPSATNGASSTPICNGTITSTGQDGDLL 653
                                  .|....|.....|.|.|:..|......:....:..:.||    
Human  1164 PHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKAPPNVKNEGPLNVVKTEKVDRSTQD---- 1224

  Fly   654 INRKLILTCHFCGIEFPDETLYFLHKGCHCESNPWRCNICGEQLNNVYEFNSHLLSKSHQ 713
               :|...|..|||.|.||.:|.||..||.:|.|::|:||.....:.|:|.:|:....|:
Human  1225 ---ELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHR 1281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12769NP_001286181.1 C2H2 Zn finger 183..203 CDD:275368 6/24 (25%)
zf-H2C2_2 195..218 CDD:290200 7/38 (18%)
C2H2 Zn finger 211..231 CDD:275368 7/33 (21%)
C2H2 Zn finger 239..255 CDD:275368 5/37 (14%)
C2H2 Zn finger 662..689 CDD:275371 14/27 (52%)
C2H2 Zn finger 690..712 CDD:275371 6/22 (27%)
TRPS1NP_054831.2 ZnF_GATA 904..947 CDD:214648 8/43 (19%)
ZnF_GATA 908..964 CDD:238123 13/70 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3390
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.