DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12769 and ztf-16

Sequence 1:NP_001286181.1 Gene:CG12769 FlyBaseID:FBgn0033252 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001024851.1 Gene:ztf-16 WormBaseID:WBGene00019960 Length:480 Species:Caenorhabditis elegans

Alignment Length:695 Identity:146/696 (21%)
Similarity:223/696 (32%) Gaps:271/696 (39%)


  Fly    40 HHNAMALRSLKDAASSAS-------ESELQEPRS-----PTPTPTNLSTGPHSPPMTFRCERCDS 92
            |.|..:..|..:.::|.:       :|....|||     |||:|.:.....|...:|........
 Worm    27 HENEHSRSSSGEMSNSQTIEWGDGIQSSTPSPRSTPPSDPTPSPDSDEHLEHHISITEITNTLIK 91

  Fly    93 FETSSRASLLLHV------VQCLAGQAAAAAAAAAASARLKSEDLQEPENMSLGHMEG-GKGDGQ 150
            .|..::....:||      ..|:             |..:||            |:|. .:..||
 Worm    92 KEPGTKGQKTVHVCPHCNFTTCM-------------SQHMKS------------HLEAHERHQGQ 131

  Fly   151 TGNGSSSSASSSPAGNSGGGGGGNSSSRKVFECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQ 215
                                         :::||:|.|:||..|||.||:|||:||||||||.|:
 Worm   132 -----------------------------MYQCDICKMQFSQKANMHRHRMRHSGVKPYECRFCK 167

  Fly   216 KRFFRKDHLAEHFTTHTKT-LPYHCPI--CNRGFQRQIAMRAHFQNEHVGQHDLVKTCPLCSYRA 277
            |||||||.:.||..||.|| ..:.||:  ||..|.:..|:|||.:..|........:|..|:...
 Worm   168 KRFFRKDQMQEHSMTHIKTGFGFDCPVSQCNMQFSQHNALRAHLEETHTISSTNPASCKRCNLMF 232

  Fly   278 GSMKSLRIHFFNRHGIDLDNPGPGGTSSLLLALESQASAAAAAAAASYVPPGLSPVPVQSQSQQQ 342
            .:.:.|.:||..||.....:|....|..........|           :|...:.:.:..|.|:.
 Worm   233 ANSRRLLLHFQTRHDDSESSPKKENTPKRKKLSNGNA-----------LPMDPANMSITEQLQRM 286

  Fly   343 QQQQVAPPASDSGESMRSLENATPPMHFLTPHVEISTLGESGNTELFNLICVWRESALQGNNNNN 407
            .:.:.:||.:|:.::..|.|....|..|...:.:|.            |:|:             
 Worm   287 VKSEFSPPNTDTSDNSTSSEFDKIPPSFPMANPDIL------------LMCL------------- 326

  Fly   408 NNNNCATNNNNNINGASNNCNSISNGNAESNGDKVKDRALIMQSPVELPMDCNTKATPITSSTTA 472
                   |..|..||...|                          :..|| .|....|:.:.   
 Worm   327 -------NQMNQFNGFGEN--------------------------IPRPM-LNIPNIPLPAL--- 354

  Fly   473 SSLSGGLKSHHQHPHHHHHHHHHHENHITPSISLIPIKQEPMSEDMDKKDLMNGSDPSSDTEQAS 537
                                      |..|:::.| :||                    |..|..
 Worm   355 --------------------------HNIPAVAAI-VKQ--------------------DQVQLW 372

  Fly   538 NNNNSSSNNNRITSLIKVSPLKSLLREDLKRRICAKANNRITRNATPLESNNNNSVLSNSLSNGS 602
            :...|||        :.||.                        .:|.|.:::.....:|||...
 Worm   373 SEQTSSS--------VSVSA------------------------PSPSEQSHSPPANESSLSLTE 405

  Fly   603 GRGSPGVNGGSGGGGGGGPPTPATPSATNGASSTPICNGTITSTGQDGDLLINRKLILTCHFCGI 667
            ...|               |||......|                           :..|| ||:
 Worm   406 KEKS---------------PTPEKEDEEN---------------------------VECCH-CGM 427

  Fly   668 EFPDETLYFLHKGCHCESNPWRCNICGEQLNNVYEFNSHLLSKSH 712
            .|.|.|:|.|||..|.:.:|::|.:||.|....|.|.:|::...|
 Worm   428 MFYDNTMYLLHKSLHSDGDPFKCALCGTQCGEKYMFTTHVIFADH 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12769NP_001286181.1 C2H2 Zn finger 183..203 CDD:275368 13/20 (65%)
zf-H2C2_2 195..218 CDD:290200 18/23 (78%)
C2H2 Zn finger 211..231 CDD:275368 13/20 (65%)
C2H2 Zn finger 239..255 CDD:275368 8/18 (44%)
C2H2 Zn finger 662..689 CDD:275371 13/27 (48%)
C2H2 Zn finger 690..712 CDD:275371 7/22 (32%)
ztf-16NP_001024851.1 C2H2 Zn finger 105..125 CDD:275368 6/45 (13%)
C2H2 Zn finger 135..155 CDD:275368 13/20 (65%)
C2H2 Zn finger 163..183 CDD:275368 13/20 (65%)
C2H2 Zn finger 225..246 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131080262
eggNOG 1 0.900 E33208_3BKBX
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I2604
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D591567at33208
OrthoFinder 1 1.000 FOG0005352
OrthoInspector 1 1.000 T374899
orthoMCL 1 0.900 OOG5_142421
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.900 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3390
TreeFam 1 0.960
1110.690

Return to query results.
Submit another query.