DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and SPE1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_012737.1 Gene:SPE1 SGDID:S000001667 Length:466 Species:Saccharomyces cerevisiae

Alignment Length:414 Identity:167/415 (40%)
Similarity:231/415 (56%) Gaps:52/415 (13%)


  Fly     4 ATPEIQFYERELNIRRVIEE-CDLQRLDQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDP 67
            |.|:| |...:..|.|:..| ||... :.:..||||..|:|....|.|.|||||||||||||.|.
Yeast    59 AHPKI-FQALKARIGRINNETCDPGE-ENSFFICDLGEVKRLFNNWVKELPRIKPFYAVKCNPDT 121

  Fly    68 MVVRLLAQLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEV 132
            .|:.|||:||..||||||.|:..||..::||:||::||||:..|.:.||....|...|.||..|:
Yeast   122 KVLSLLAELGVNFDCASKVEIDRVLSMNISPDRIVYANPCKVASFIRYAASKNVMKSTFDNVEEL 186

  Fly   133 YKLHTHYPNSNLIVRFKSEAKEAQCPLGDKFGCDAD-VDAAALMLLAKSLELKVTGTSFHVGSGC 196
            :|:...:|.|.|::|..::...|||.|..|:||:.: ||  .|:...|.|.|.:.|.|||||||.
Yeast   187 HKIKKFHPESQLLLRIATDDSTAQCRLSTKYGCEMENVD--VLLKAIKELGLNLAGVSFHVGSGA 249

  Fly   197 SELQAYDRAIKKAKNLF-----KFGALLGYDMDFLDIGGGFPGSDDVKFEKIAES---VNTSVQR 253
            |:..:..:|::.|:.:|     ::|.   ..:..||:||||      :||...||   :..:::.
Yeast   250 SDFTSLYKAVRDARTVFDKAANEYGL---PPLKILDVGGGF------QFESFKESTAVLRLALEE 305

  Fly   254 HFP-DERVHIIAEPGRFFVAAACTLVCKIHAKREI-RNEAGKLDTVMYYLNDGVYGSFNCILYDH 316
            .|| ...|.|||||||:|||.|.||...:.|||:: .|||      |.|.||||||:.||||:||
Yeast   306 FFPVGCGVDIIAEPGRYFVATAFTLASHVIAKRKLSENEA------MIYTNDGVYGNMNCILFDH 364

  Fly   317 QVV--------IAEHYLDNAESLPHLKSL------------IWGPSCDALDKISEDLHLP-NLNR 360
            |..        :..||.|...:...|.|:            ||||:||.||.|:::.::. ::..
Yeast   365 QEPHPRTLYHNLEFHYDDFESTTAVLDSINKTRSEYPYKVSIWGPTCDGLDCIAKEYYMKHDVIV 429

  Fly   361 GDLLGFRNMGAYTMPIASAFNGFE 384
            ||...|..:||||...|:.|||||
Yeast   430 GDWFYFPALGAYTSSAATQFNGFE 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 163/403 (40%)
PLPDE_III_ODC 30..391 CDD:143482 158/388 (41%)
SPE1NP_012737.1 LysA 60..460 CDD:223098 166/414 (40%)
PLPDE_III_ODC 84..460 CDD:143482 158/388 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37194774
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 1 1.000 H1906
Inparanoid 1 1.050 260 1.000 Inparanoid score I622
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T634571
orthoMCL 1 0.900 OOG5_126750
Panther 1 1.100 LDO PTHR11482
Phylome 1 0.910 0.720 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R297
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.