DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and AT3G14390

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_188056.1 Gene:AT3G14390 AraportID:AT3G14390 Length:484 Species:Arabidopsis thaliana

Alignment Length:380 Identity:91/381 (24%)
Similarity:158/381 (41%) Gaps:71/381 (19%)


  Fly    41 VERKLRLWQKLLPRIKPF--YAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVL--GFDVSPERI 101
            :.|.|..:::.|..:...  ||:|.|::..::..|..||.|....|.||::|.|  |||  |.:.
plant   102 ITRNLEAYKEALEGVSSVIGYAIKANNNLKILEHLRSLGCGAVLVSGNELRLALRAGFD--PTKC 164

  Fly   102 IFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKL----HTHYPNSNLIVRFKSEAKEAQCPL--- 159
            ||....:.:..|..|.:..|. ..||:||::..:    .......|:::|...:......|.   
plant   165 IFNGNGKSLEDLVLAAQEGVF-VNVDSEFDLNNIVEASRISGKQVNVLLRINPDVDPQVHPYVAT 228

  Fly   160 ---GDKFGCDAD-----VDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKNLFKFG 216
               ..|||...:     :|    .:.|...|||:.|...|:||..:::           ::|:..
plant   229 GNKNSKFGIRNEKLQWFLD----QVKAHPKELKLVGAHCHLGSTITKV-----------DIFRDA 278

  Fly   217 ALL-----------GYDMDFLDIGGGFPGSDDVKFEKI----AESVNTSVQRHFPDERVHIIAEP 266
            |:|           |:::.:|:||||. |.|......:    .:.:|| |:.......:::|.||
plant   279 AVLMIEYIDEIRRQGFEVSYLNIGGGL-GIDYYHAGAVLPTPMDLINT-VRELVLSRDLNLIIEP 341

  Fly   267 GRFFVAAACTLVCKIHAKREIRNEAGKLDTVMYYLNDGVYGS-FNCILYDHQVVIAEHYLDNAES 330
            ||..:|..|   |.::....::...    |..:.:.||.... ....|||     |..:::....
plant   342 GRSLIANTC---CFVNHVTGVKTNG----TKNFIVIDGSMAELIRPSLYD-----AYQHIELVSP 394

  Fly   331 LPH----LKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFN 381
            .|.    .|..:.||.|::.|.:.:|..||...:|..|...:.|||.|.:||.:|
plant   395 PPAEAEVTKFDVVGPVCESADFLGKDRELPTPPQGAGLVVHDAGAYCMSMASTYN 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 91/381 (24%)
PLPDE_III_ODC 30..391 CDD:143482 91/381 (24%)
AT3G14390NP_188056.1 PLN02537 75..484 CDD:178152 91/381 (24%)
PLPDE_III_DapDC 93..459 CDD:143501 91/381 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2405
OMA 1 1.010
OrthoDB 1 1.010 D725914at2759
OrthoInspector 1 1.000 T32387
orthoMCL 1 0.900 OOG5_126750
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.776 Consistency score
65.880

Return to query results.
Submit another query.