DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and Azin1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001288631.1 Gene:Azin1 RGDID:61934 Length:448 Species:Rattus norvegicus

Alignment Length:372 Identity:139/373 (37%)
Similarity:211/373 (57%) Gaps:17/373 (5%)


  Fly    32 ALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDV 96
            |..:.||..:.:|...||.::.:|||||.||||..|.|:.:||.||.||.|:||||:.||....|
  Rat    39 AFFVGDLGKIVKKHSQWQNVVAQIKPFYMVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGV 103

  Fly    97 SPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKSEAKEAQCPLGD 161
            |||.||:.:||:..|.::||.:..|:..|.|||.|:.|:..::||:.:::...:|..........
  Rat   104 SPENIIYTSPCKQASQIKYAAKVGVNIMTCDNEVELKKIARNHPNAKVLLHIATEDNIGGEDGNM 168

  Fly   162 KFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFL 226
            |||.... :...|:..||.|::::.|..||:.|.|.|.|.|..|:..|:.:|......|:.|:.|
  Rat   169 KFGTTLK-NCRHLLECAKELDVQIIGVKFHISSACKEYQVYVHALSDARCVFDMAGEFGFTMNML 232

  Fly   227 DIGGGFPGSDDVKFEKIAESVNTSVQRHFPD-ERVHIIAEPGRFFVAAACTLVCKIHAKREIRNE 290
            ||||||.|: :::.|::...::..:..:||: ..:.||:|||.::|::|.||...|.||:.:.|:
  Rat   233 DIGGGFTGT-EIQLEEVNHVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVEND 296

  Fly   291 AGKLDT-----------VMYYLNDGVYGSFNCILYDHQVVIAEHYLDNAESLPHLKSLIWGPSCD 344
              ||.:           .:||:||||||||...|.:....:.|.:....|..|...|.:||||||
  Rat   297 --KLSSGVEKNGSDEPAFVYYMNDGVYGSFASKLSEDLNTVPEVHKKYKEDEPLFTSSLWGPSCD 359

  Fly   345 ALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYF 391
            .||:|.|...||.|:.||.|.|.||||.::...|||:..:.| .:||
  Rat   360 ELDQIVESCLLPELSVGDWLIFDNMGADSLHGPSAFSDTQRP-AIYF 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 138/371 (37%)
PLPDE_III_ODC 30..391 CDD:143482 138/371 (37%)
Azin1NP_001288631.1 PLPDE_III_ODC_like_AZI 26..419 CDD:143504 139/373 (37%)
LysA 40..405 CDD:223098 137/370 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37155318
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 322 1.000 Inparanoid score I2387
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131175
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11482
Phylome 1 0.910 0.627 Consistency score
TreeFam 1 0.960
109.870

Return to query results.
Submit another query.