DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and azin1a

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001017568.2 Gene:azin1a ZFINID:ZDB-GENE-050417-20 Length:454 Species:Danio rerio

Alignment Length:412 Identity:140/413 (34%)
Similarity:220/413 (53%) Gaps:38/413 (9%)


  Fly     8 IQFYERELNIRRVIEECDLQRLDQ------ALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDD 66
            ::..|....:|.||   |....||      |....||..:.::...|:..:.:|:|||.||.|..
Zfish    14 VELLEGSAALRDVI---DKHIYDQTFAQKSAFFAADLGVIVQQQARWRNKMDQIRPFYTVKSNSS 75

  Fly    67 PMVVRLLAQLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFE 131
            |:||.|||.||.||.|::|:|:.||.||.||.:.||....|:.:||::||.:|.:.....|||.|
Zfish    76 PVVVELLASLGTGFICSNKHELDLVKGFGVSSQDIILGGTCKQLSHIKYAAKHNIPLLVCDNEAE 140

  Fly   132 VYKLHTHYPNSNLIVRFKSEA----KEAQCPLGDKF-GCDADVDAAALMLLAKSLELKVTGTSFH 191
            :.|:...:|.:.:::...||:    :|...|.|... .|...::.|     |..|.|:|||..|:
Zfish   141 MRKIARCHPKAKVLLLLTSESCCEKEEMAIPFGSTLKDCRRLLECA-----AGELNLQVTGVKFN 200

  Fly   192 VGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPGSDDVKFEKIAESVNTSVQRHFP 256
            :.|.|.|::.:.||:.:|:.:|..|..||::|:.|||||||.||:: :.:|:.:.:...:..:||
Zfish   201 IPSCCQEVEKFSRAVSEARCVFDMGEELGFEMNILDIGGGFDGSEE-QLDKVNQMLKPMLDMYFP 264

  Fly   257 -DERVHIIAEPGRFFVAAACTLVCKIHAKREIRNE----------AGKLDTVMYYLNDGVYGSF- 309
             ...:.||||||.::|::|.||...|..|:.:..:          |......:|::|||||||| 
Zfish   265 RSTGLSIIAEPGAYYVSSAFTLAVNIIDKKTVARDCSAQPHDALSANDEPEFLYHINDGVYGSFA 329

  Fly   310 NCILYDHQVV--IAEHYLDNAESLPHLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAY 372
            :.:|.:..:.  :|..::...|  |...|.:||||.|.||.:.|...||.|:.||.|.|||.|| 
Zfish   330 SKLLCEDSIATPLAHKHVSADE--PLFSSSLWGPSEDDLDLVMERCLLPELSVGDWLLFRNAGA- 391

  Fly   373 TMPIASAFNGFEVPKTLYFQAI 394
             ..:.|||:..:..|...|.:|
Zfish   392 -SALGSAFSHGDQHKPPVFYSI 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 137/400 (34%)
PLPDE_III_ODC 30..391 CDD:143482 133/386 (34%)
azin1aNP_001017568.2 PLPDE_III 28..424 CDD:294187 136/396 (34%)
dCO2ase_PEP1 42..401 CDD:132143 129/369 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37125656
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306092at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11482
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.