DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and azin2

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001015993.2 Gene:azin2 XenbaseID:XB-GENE-6454420 Length:458 Species:Xenopus tropicalis

Alignment Length:386 Identity:166/387 (43%)
Similarity:244/387 (63%) Gaps:13/387 (3%)


  Fly    10 FYERELNIRRVIEECDLQRLDQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLA 74
            |..|:| :..:|.|........|..:.||..|.:|...:.|.|||:|||||||||....||::||
 Frog    17 FMARDL-MEEIINEVSQTEDRDAFFVADLGDVVKKHLRFLKALPRVKPFYAVKCNSSRGVVKILA 80

  Fly    75 QLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHY 139
            :||||||||||.|::||....|:|||||:||||:.:|.:::|.:..|...|.|||.|:.|:..::
 Frog    81 ELGAGFDCASKTEIELVQDIGVTPERIIYANPCKQISQIKFAAKTGVQMMTFDNEVELSKVSRNH 145

  Fly   140 PNSNLIVRFKSEAKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDR 204
            ||:.:::|..::..::...|..|||.... ....|:.:||:|.:.|.|.||||||||::.:||.:
 Frog   146 PNARMVLRIATDDSKSSARLSVKFGAPLK-SCRRLLEMAKNLSVDVIGVSFHVGSGCTDSKAYTQ 209

  Fly   205 AIKKAKNLFKFGALLGYDMDFLDIGGGFPGSDD--VKFEKIAESVNTSVQRHFPD-ERVHIIAEP 266
            ||..|:.:|:..:..||:|..|||||||||::|  ::||::|..:|.::..:||: ..|.|||||
 Frog   210 AIADARLVFEMASEFGYNMWLLDIGGGFPGTEDSKIRFEEMAGVINPALDLYFPEGSDVQIIAEP 274

  Fly   267 GRFFVAAACTLVCKIHAKREI--------RNEAGKLDTVMYYLNDGVYGSFNCILYDHQVVIAEH 323
            ||::|.:|.:|...|.||:|:        ..|.|....:|||:||||||||||:::||.......
 Frog   275 GRYYVTSAFSLAVNIIAKKEVLMEHSGSDDEENGPNKNIMYYVNDGVYGSFNCLVFDHAHPKPIL 339

  Fly   324 YLDNAESLPHLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFE 384
            :...:...|...|.:|||:||.||:|:|:|.||..:.||.|.|.||||||:..:|.||||:
 Frog   340 HKKPSPDQPLYTSSLWGPTCDGLDQIAENLLLPEHHVGDWLLFENMGAYTIAASSNFNGFQ 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 163/381 (43%)
PLPDE_III_ODC 30..391 CDD:143482 161/367 (44%)
azin2NP_001015993.2 LysA 17..404 CDD:223098 166/387 (43%)
PLPDE_III_ODC 37..406 CDD:143482 161/366 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37134765
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 329 1.000 Inparanoid score I2276
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T129194
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R297
TreeFam 1 0.960
109.890

Return to query results.
Submit another query.