DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and Azin1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001095928.1 Gene:Azin1 MGIID:1859169 Length:448 Species:Mus musculus

Alignment Length:370 Identity:144/371 (39%)
Similarity:209/371 (56%) Gaps:13/371 (4%)


  Fly    32 ALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDV 96
            |..:.||..:.:|...||.::.:|||||.||||..|.|:.:||.||.||.|:||||:.||....|
Mouse    39 AFFVGDLGKIVKKHSQWQTVVAQIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGV 103

  Fly    97 SPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKSEAKEAQCPLGD 161
            |||.|||.:||:.||.::||.:..|:..|.|||.|:.|:..::||:.:::...:|..........
Mouse   104 SPENIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEDGNM 168

  Fly   162 KFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFL 226
            |||.... :...|:..||.|::::.|..|||.|.|.|.|.|..|:..|:.:|......|:.|:.|
Mouse   169 KFGTTLK-NCRHLLECAKELDVQIIGVKFHVSSACKEYQVYVHALSDARCVFDMAGEFGFTMNML 232

  Fly   227 DIGGGFPGSDDVKFEKIAESVNTSVQRHFPD-ERVHIIAEPGRFFVAAACTLVCKIHAKREIRNE 290
            ||||||.|: :::.|::...::..:..:||: ..:.||:|||.::|::|.||...|.||:.:.|:
Mouse   233 DIGGGFTGT-EIQLEEVNHVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVEND 296

  Fly   291 ---------AGKLDTVMYYLNDGVYGSFNCILYDHQVVIAEHYLDNAESLPHLKSLIWGPSCDAL 346
                     .......:||:||||||||...|.:....|.|.:....|..|...|.:||||||.|
Mouse   297 KFSSGVEKNGSDEPAFVYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDEL 361

  Fly   347 DKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYF 391
            |:|.|...||.||.||.|.|.||||.:....||||.|:.| .:||
Mouse   362 DQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRP-AIYF 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 143/369 (39%)
PLPDE_III_ODC 30..391 CDD:143482 143/369 (39%)
Azin1NP_001095928.1 PLPDE_III_ODC_like_AZI 26..419 CDD:143504 144/371 (39%)
LysA 40..405 CDD:223098 142/368 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37152568
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 317 1.000 Inparanoid score I2513
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306092at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130933
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11482
Phylome 1 0.910 0.639 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.860

Return to query results.
Submit another query.