DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and AZIN1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001349953.1 Gene:AZIN1 HGNCID:16432 Length:448 Species:Homo sapiens

Alignment Length:376 Identity:146/377 (39%)
Similarity:212/377 (56%) Gaps:20/377 (5%)


  Fly    32 ALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDV 96
            |..:.||..:.:|...||.::.:|||||.||||..|.|:.:||.||.||.|:||||:.||....|
Human    39 AFFVGDLGKIVKKHSQWQNVVAQIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGV 103

  Fly    97 SPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKSE----AKEAQC 157
            .||.||:.:||:.||.::||.:..|:..|.|||.|:.|:..::||:.:::...:|    .:|...
Human   104 PPENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNM 168

  Fly   158 PLGDKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYD 222
                |||.... :...|:..||.|::::.|..|||.|.|.|.|.|..|:..|:.:|.....:|:.
Human   169 ----KFGTTLK-NCRHLLECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEIGFT 228

  Fly   223 MDFLDIGGGFPGSDDVKFEKIAESVNTSVQRHFPD-ERVHIIAEPGRFFVAAACTLVCKIHAKRE 286
            |:.|||||||.|: :.:.|::...::..:..:||: ..|.||:|||.::|::|.||...|.||:.
Human   229 MNMLDIGGGFTGT-EFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSAFTLAVNIIAKKV 292

  Fly   287 IRNE---AGKLDT------VMYYLNDGVYGSFNCILYDHQVVIAEHYLDNAESLPHLKSLIWGPS 342
            :.|:   :|...|      .|||:||||||||...|.:....|.|.:....|..|...|.:||||
Human   293 VENDKFPSGVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPS 357

  Fly   343 CDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYFQA 393
            ||.||:|.|...||.||.||.|.|.||||.:....||||.|:.|...|..:
Human   358 CDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMS 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 146/373 (39%)
PLPDE_III_ODC 30..391 CDD:143482 146/373 (39%)
AZIN1NP_001349953.1 PLPDE_III_ODC_like_AZI 26..419 CDD:143504 146/377 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37156455
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I2494
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11482
Phylome 1 0.910 0.658 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.