DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and ODC1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001274118.1 Gene:ODC1 HGNCID:8109 Length:461 Species:Homo sapiens

Alignment Length:392 Identity:178/393 (45%)
Similarity:241/393 (61%) Gaps:37/393 (9%)


  Fly    29 LDQALN------------ICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFD 81
            |||.:|            :.||..:.:|...|.|.|||:.|||||||||...:|:.||..|.|||
Human    24 LDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFD 88

  Fly    82 CASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIV 146
            ||||.|::||....|.|||||:||||:.||.::||..:.|...|.|:|.|:.|:...:|.:.|::
Human    89 CASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVL 153

  Fly   147 RFKSEAKEAQCPLGDKFGCDADVDAAALML-LAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAK 210
            |..::..:|.|.|..|||  |.:..:.|:| .||.|.:.|.|.||||||||::.:.:.:||..|:
Human   154 RIATDDSKAVCRLSVKFG--ATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDAR 216

  Fly   211 NLFKFGALLGYDMDFLDIGGGFPGSDDV--KFEKIAESVNTSVQRHFP-DERVHIIAEPGRFFVA 272
            .:|..||.:|:.|..||||||||||:||  |||:|...:|.::.::|| |..|.|||||||::||
Human   217 CVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVA 281

  Fly   273 AACTLVCKIHAKR-EIRNEAGKLD-------TVMYYLNDGVYGSFNCILYDHQVVIAEHYLDNAE 329
            :|.||...|.||: .::.:.|..|       |.|||:|||||||||||||||     .|.....:
Human   282 SAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDH-----AHVKPLLQ 341

  Fly   330 SLP-----HLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTL 389
            ..|     :..|.||||:||.||:|.|...||.::.||.:.|.||||||:..||.||||:.| |:
Human   342 KRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRP-TI 405

  Fly   390 YF 391
            |:
Human   406 YY 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 178/391 (46%)
PLPDE_III_ODC 30..391 CDD:143482 177/390 (45%)
ODC1NP_001274118.1 PLPDE_III_ODC 37..408 CDD:143482 174/380 (46%)
LysA 40..408 CDD:223098 174/377 (46%)
Pyridoxal phosphate binding. {ECO:0000244|PDB:2OO0, ECO:0000269|PubMed:17407445, ECO:0000269|PubMed:26305948, ECO:0000269|PubMed:26443277} 274..277 3/3 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P07805} 331..332 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37137192
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 1 1.000 H1906
Inparanoid 1 1.050 319 1.000 Inparanoid score I2494
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T130155
orthoMCL 1 0.900 OOG5_126750
Panther 1 1.100 LDO PTHR11482
Phylome 1 0.910 0.662 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R297
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.