DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and azin1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001007944.1 Gene:azin1 XenbaseID:XB-GENE-948396 Length:442 Species:Xenopus tropicalis

Alignment Length:372 Identity:122/373 (33%)
Similarity:192/373 (51%) Gaps:14/373 (4%)


  Fly    32 ALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDV 96
            |..:.||..:.:|...|:.::.|:.|||.|:||..|.|:.:||.|..||.||:|||:.||....:
 Frog    39 AFFVADLGKIVKKHFKWKNIMGRVNPFYTVRCNSSPAVLEILAALSMGFACANKNEMSLVYDLGI 103

  Fly    97 SPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKSEAKEAQCPLGD 161
            ..|..::.|||:..|.:::|.:..|:..|.|:|.|:.|:..::.|:.|::...:|....:..:..
 Frog   104 PMENAVYTNPCKQASQIKHAAKIGVNLMTCDSETELKKIARNHFNAKLLLHIATEGISGEEDMNM 168

  Fly   162 KFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFL 226
            .||.... :...|:..||.|.::|.|..|||.|. :..|.|..|:..|:.:|.....||:.|:.|
 Frog   169 TFGTTLK-NCRHLLECAKELSVEVVGVKFHVSSS-NNPQTYIHALSDARCVFDMAEELGFKMNIL 231

  Fly   227 DIGGGFPGSDDVKFEKIAESVNTSVQRHFPD-ERVHIIAEPGRFFVAAACTLVCKIHAKREIRNE 290
            ||||  ...::.:.|::.::|:..:..:||: ....||||||.|:|::|.||...:.||..|.::
 Frog   232 DIGG--ISENEAQLEELYQAVSPLLDVYFPEGSGTRIIAEPGSFYVSSAFTLAVNVMAKNVIEHD 294

  Fly   291 -----AGK----LDTVMYYLNDGVYGSFNCILYDHQVVIAEHYLDNAESLPHLKSLIWGPSCDAL 346
                 |||    ....:|.:|:||||||...|.:......|.:....:..|...|.:.|||.|.|
 Frog   295 QHLPSAGKQISNKPAFIYCMNEGVYGSFARKLSEKLNTAPEVHKKYKDDEPLFASSLLGPSYDEL 359

  Fly   347 DKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYFQA 393
            |.|.|...||.|..||.:.|.|||..::...|.|..||.|....|.:
 Frog   360 DVIVEHCLLPELEVGDWVVFENMGCGSLNEQSPFADFEKPSLYNFMS 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 121/369 (33%)
PLPDE_III_ODC 30..391 CDD:143482 121/369 (33%)
azin1NP_001007944.1 PLPDE_III_ODC_like_AZI 26..417 CDD:143504 122/373 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37120526
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 329 1.000 Inparanoid score I2276
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306092at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T129194
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.850

Return to query results.
Submit another query.