DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and odc1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001005441.1 Gene:odc1 XenbaseID:XB-GENE-478945 Length:460 Species:Xenopus tropicalis

Alignment Length:417 Identity:185/418 (44%)
Similarity:248/418 (59%) Gaps:50/418 (12%)


  Fly     7 EIQFYERELNIRRVIE----ECDLQRLDQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDP 67
            :..|.|.....|.::|    |..|.....|..:.||..:.:|...|.|.|||:.|||||||||..
 Frog    10 DFSFLEEGFCARDIVEQKINEVSLSDDKDAFYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSK 74

  Fly    68 MVVRLLAQLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEV 132
            .:|:.|:.||||||||||.|::||....||.||||:||||:.||.::||....|...|.|:|.|:
 Frog    75 AIVKTLSLLGAGFDCASKTEIQLVQSIGVSSERIIYANPCKQVSQIKYAASCGVEKMTFDSEVEL 139

  Fly   133 YKLHTHYPNSNLIVRFKSEAKEAQCPLGDKFGCDADVDAAALML-LAKSLELKVTGTSFHVGSGC 196
            .|:..::||:.|::|..::..:|.|.|..|||  |.:..:.|:| .||.|.:::.|.||||||||
 Frog   140 MKVARNHPNAKLVLRIATDDSKAVCRLSVKFG--ATLKTSRLLLERAKELNVEIIGVSFHVGSGC 202

  Fly   197 SELQAYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPGSDDV--KFEKIAESVNTSVQRHFP-DE 258
            ::.|.|.:|:..|:.:|..||.||:.|..||||||||||:||  |||:|...:|.::.::|| |.
 Frog   203 TDPQTYVQAVSDARCVFDMGAELGFSMHLLDIGGGFPGSEDVKLKFEEITSVINPALDKYFPVDS 267

  Fly   259 RVHIIAEPGRFFVAAACTLVCKIHAKREIRNEAGKLD---------TVMYYLNDGVYGSFNCILY 314
            .|.|||||||::||:|.||...|.||:.:.||....|         |:|||:||||||||||||:
 Frog   268 GVTIIAEPGRYYVASAFTLAVNIIAKKVMVNEQSGSDDEEDAANDKTLMYYVNDGVYGSFNCILF 332

  Fly   315 DHQVVIAEHYLDNAESLPHLK---------------SLIWGPSCDALDKISEDLHLPNLNRGDLL 364
            ||               .|:|               |.||||:||.||:|.|...||.|..||.:
 Frog   333 DH---------------AHVKPVLTKKPKPDESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWM 382

  Fly   365 GFRNMGAYTMPIASAFNGFEVPKTLYF 391
            .|.||||||:..:|.||||:.| |||:
 Frog   383 LFENMGAYTVAASSTFNGFQRP-TLYY 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 183/407 (45%)
PLPDE_III_ODC 30..391 CDD:143482 179/389 (46%)
odc1NP_001005441.1 PLPDE_III_ODC 37..409 CDD:143482 179/391 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37143144
eggNOG 1 0.900 E1_COG0019
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1906
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.