DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and Azin2

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001014283.2 Gene:Azin2 RGDID:1564776 Length:459 Species:Rattus norvegicus

Alignment Length:408 Identity:147/409 (36%)
Similarity:232/409 (57%) Gaps:19/409 (5%)


  Fly     1 MAAATPEIQF--YERELNIRRVIEECDLQRLD------QALNICDLSSVERKLRLWQKLLPRIKP 57
            ||....|..|  .|...:.|.::||..|....      .|..:.||.:|.||...:.|.|||::|
  Rat     1 MAGYLSESDFVMVEEGFSTRDLLEELTLGASQATTGKVAAFFVADLGAVVRKHFCFLKYLPRVRP 65

  Fly    58 FYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVS 122
            ||||:||....|:::||:||.||.||||.|::||....|...:||.||||:.|:.::||.:|.|.
  Rat    66 FYAVRCNSSLGVLKVLAELGLGFSCASKAEMELVQHIGVPASKIICANPCKQVAQIKYAAKHGVR 130

  Fly   123 NGTVDNEFEVYKLHTHYPNSNLIVRFKSEAKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVTG 187
            ..:.|||.|:.|:...:|::.:::...::...:...|..:||.... ....|:..||...::|.|
  Rat   131 LLSFDNEVELAKVVKSHPSAKMVLCIATQDSHSLNHLSLRFGASLK-SCRHLLENAKQSHVEVVG 194

  Fly   188 TSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPGSD--DVKFEKIAESVNTS 250
            .|||:||||.:.|||.::|..|:.:|:.||.||:.|:.||:||||||.:  .|:||::|..:|::
  Rat   195 VSFHIGSGCPDPQAYAQSIADARLVFQMGAELGHTMNILDLGGGFPGLEGAKVRFEEMASVINSA 259

  Fly   251 VQRHFPDE-RVHIIAEPGRFFVAAACTLVCKIHAKREIRNEAGKLD-------TVMYYLNDGVYG 307
            :..:||:. .|.|:||.||::|.:|.|:...|.||:|:.::..:.:       :::|:|::||||
  Rat   260 LDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKKEVLDQPSREEQTGAAPKSIVYHLDEGVYG 324

  Fly   308 SFNCILYDHQVVIAEHYLDNAESLPHLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAY 372
            .||.:|:|:...........:...|...|.:|||:.|..|.::|.|.||.|..||.|.|.|||||
  Rat   325 VFNSVLFDNTCPTPALQKKPSADQPLYSSSLWGPAVDGCDCVAEGLWLPQLQVGDWLVFDNMGAY 389

  Fly   373 TMPIASAFNGFEVPKTLY 390
            |:...|...|.:..:..|
  Rat   390 TVDTKSLLGGTQACRVTY 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 142/392 (36%)
PLPDE_III_ODC 30..391 CDD:143482 138/378 (37%)
Azin2NP_001014283.2 LysA 8..390 CDD:223098 140/383 (37%)
PLPDE_III_ODC 40..407 CDD:143482 137/368 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37104937
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11482
Phylome 1 0.910 0.639 Consistency score
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.