DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and Odc2

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_477053.2 Gene:Odc2 FlyBaseID:FBgn0013308 Length:393 Species:Drosophila melanogaster

Alignment Length:386 Identity:286/387 (74%)
Similarity:338/387 (87%) Gaps:1/387 (0%)


  Fly     8 IQFYERELNIRRVIEECDLQRLDQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRL 72
            ||:|:.|||||:|||:.||:.||||||||||||:|||||||.||:|||:|.|||||||||:||:.
  Fly     8 IQYYDEELNIRKVIEQADLEHLDQALNICDLSSLERKLRLWHKLMPRIEPHYAVKCNDDPVVVKF 72

  Fly    73 LAQLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHT 137
            ||.||.|||||||||:|||||..|||||||||:||||.|||.||||.||.|||||||:|:|||..
  Fly    73 LADLGTGFDCASKNELKLVLGLGVSPERIIFAHPCRPASHLRYAKEQQVVNGTVDNEYEIYKLRK 137

  Fly   138 HYPNSNLIVRFKSEAKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAY 202
            |||:||||||||||||:|.||||||:||||:.||||||||||:|.||||||||||||||||::||
  Fly   138 HYPDSNLIVRFKSEAKKALCPLGDKYGCDAEADAAALMLLAKALGLKVTGTSFHVGSGCSEVEAY 202

  Fly   203 DRAIKKAKNLFKFGALLGYDMDFLDIGGGFPGSDDVKFEKIAESVNTSVQRHFPDERVHIIAEPG 267
            ||||:||:|:||.|.::|:.|:.||:||||||.||..||:||:||||||:..|||:|:.||:|||
  Fly   203 DRAIEKAENIFKVGEMIGHKMELLDVGGGFPGIDDEMFEEIAQSVNTSVELRFPDKRIRIISEPG 267

  Fly   268 RFFVAAACTLVCKIHAKREIRNEAGKLDTVMYYLNDGVYGSFNCILYDHQVVIAEHYLDNAESLP 332
            ||||.||.||:||:|||||:|::.|||||:|||||||::|:|..:.|..:.|..|.|||.|||||
  Fly   268 RFFVEAAYTLICKVHAKREVRSKDGKLDTMMYYLNDGIFGAFAGMFYYPEEVAPELYLDEAESLP 332

  Fly   333 HLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYFQA 393
            .|||:||||||||:|||| ||.|||||.||||||||||||||||||.||||:||:|.:|:|
  Fly   333 KLKSVIWGPSCDAMDKIS-DLLLPNLNPGDLLGFRNMGAYTMPIASPFNGFDVPETRFFKA 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 279/375 (74%)
PLPDE_III_ODC 30..391 CDD:143482 270/361 (75%)
Odc2NP_477053.2 LysA 21..385 CDD:223098 273/365 (75%)
PLPDE_III_ODC 30..390 CDD:143482 270/361 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C35365714
eggNOG 1 0.900 E1_COG0019
Homologene 1 1.000 H1906
Inparanoid 1 1.050 69 1.000 Inparanoid score I2405
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
orthoMCL 1 0.900 OOG5_126750
Panther 1 1.100 P PTHR11482
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.