DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and Ldc1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_006503256.1 Gene:Ldc1 MGIID:2685699 Length:469 Species:Mus musculus

Alignment Length:367 Identity:142/368 (39%)
Similarity:213/368 (58%) Gaps:29/368 (8%)


  Fly    17 IRRVIEECDLQRLDQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFD 81
            :.:.|:|..:.....|..:.||..:..:.|.:.:.|||::||||||||.:|.|:.:||.||.|||
Mouse    36 VLKKIKELSISGRQDAFMVADLDVLVSRHRTFLQALPRVQPFYAVKCNSNPWVLLVLAALGTGFD 100

  Fly    82 CASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIV 146
            |||:.|::.|||..|:|.||||||||:.|||:::|....|...|.|||.|:.||..::|.:.|::
Mouse   101 CASQGELEQVLGLGVAPSRIIFANPCKAVSHIQFAARCGVQLLTFDNEEELIKLARYHPRARLVL 165

  Fly   147 RFKSEAKEAQCPLGDKFGCDADVDAAA-LMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAK 210
            |.::...::..||..|||  |.::|.. |:.:|:.|.|.|.|.||||||.|...::|.:||....
Mouse   166 RIQTLDSQSTFPLHTKFG--AHLEACGHLLQVARELGLAVVGASFHVGSDCHTPESYRQAIADCH 228

  Fly   211 NLFKFGALLGYDMDFLDIGGGFPG--SDDVKFEKIAESVNTSVQRHFPDER-VHIIAEPGRFFVA 272
            .:|:.|...|:.|..||:||||||  ..:.|||::|..:||::.::||:|. :.:|||||||:..
Mouse   229 RVFEMGCKAGHHMSLLDLGGGFPGVKGSEAKFEEVARVINTALAQYFPEETGIEVIAEPGRFYAG 293

  Fly   273 AACTLVCKIHAKREIRNEAG--KLDTVMYYLNDGVYGSFNCILYDH----QVVIAEHYLDNAESL 331
            :.||....|..|:...:..|  ||   .||||:|.||.|...|.|.    .:|:.|.    ....
Mouse   294 SVCTAAVNIIVKKSSLDPGGHRKL---AYYLNEGHYGVFRLFLRDPVPRIPIVVKEF----PSEP 351

  Fly   332 PHLKSLIWGPSCDALDKI-SEDLHLPNLNRGDLLGFRNMGAY 372
            |.....::||:|||.|:: |.::.||.|         ::|||
Mouse   352 PLFPCTLYGPTCDAYDRLFSTEVQLPEL---------DVGAY 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 142/368 (39%)
PLPDE_III_ODC 30..391 CDD:143482 140/355 (39%)
Ldc1XP_006503256.1 PLPDE_III_ODC 50..382 CDD:143482 137/350 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37148380
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 317 1.000 Inparanoid score I2513
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T130933
orthoMCL 1 0.900 OOG5_126750
Panther 1 1.100 O PTHR11482
Phylome 1 0.910 0.632 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.