DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and azin1b

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001007160.2 Gene:azin1b ZFINID:ZDB-GENE-030121-1 Length:436 Species:Danio rerio

Alignment Length:402 Identity:140/403 (35%)
Similarity:213/403 (53%) Gaps:27/403 (7%)


  Fly     8 IQFYERELNIRRVIE----ECDLQRLDQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPM 68
            |:..|....:..||:    |.:|.. ..|..:.||.::.|:..:|:..:|.::|||.|.||..|:
Zfish    12 IELLEGGTTLENVIDNHIYEQNLAE-KNAFVVADLGALMRQHVVWKTTMPLVRPFYPVSCNSSPV 75

  Fly    69 VVRLLAQLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVY 133
            |:.||:.||.||.||:|.|..|||..||.||.||.:..|:.:|.:::|.:..::....:||.|:.
Zfish    76 VIELLSALGVGFVCANKAETTLVLSHDVPPENIILSGVCKQLSLIKHAAKTGINFLLCENEAELR 140

  Fly   134 KLHTHYPNSNLIVRFKSEA--KEAQCPLGDKF-GCDADVDAAALMLLAKSLELKVTGTSFHVGSG 195
            |:...:|.:.|:::..:||  :||...:|... ||      ..|:.|||.|.:.|.|.:|.|.:.
Zfish   141 KIARAHPEAKLLLQVSTEAQIEEASVTIGCSLKGC------RHLLELAKELNVSVAGVTFQVPAS 199

  Fly   196 CSELQAYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPGSDDVKFEKIAESVNTSVQRHFPDER- 259
            |.:.|||..|:..|:.:|..|..||:||:.|||||||.|| :.:.:::...:...::.:||.|. 
Zfish   200 CKDPQAYTHALSDARCIFDMGKELGFDMNILDIGGGFSGS-EFQLKQVHSVIRPLLEAYFPSESG 263

  Fly   260 VHIIAEPGRFFVAAACTLVCKIHAKR-EIRN---------EAGKLDTVMYYLNDGVYGSFNCILY 314
            |.||||||.|||.:..||...:..|: ..||         .:......:||:||||||||...|:
Zfish   264 VSIIAEPGNFFVFSCFTLAVNVIGKKAAYRNLHTSTHDKLTSSDAPEFVYYMNDGVYGSFMGRLF 328

  Fly   315 DHQV-VIAEHYLDNAESLPHLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIAS 378
            .:.: ..:.|.:......|...|.:||||||.||::.|...||.|..||.|.|.||||......:
Zfish   329 GNIISTPSVHKMSLTLDEPVFSSSLWGPSCDPLDQVVERCLLPELAVGDWLVFSNMGASGQEGPA 393

  Fly   379 AFNGFEVPKTLY 390
            .|:..:.|...|
Zfish   394 TFSDTDQPPVYY 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 138/395 (35%)
PLPDE_III_ODC 30..391 CDD:143482 134/377 (36%)
azin1bNP_001007160.2 PLPDE_III_ODC_like_AZI 26..419 CDD:143504 136/389 (35%)
dCO2ase_PEP1 40..395 CDD:132143 130/362 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37157411
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306092at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128667
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11482
Phylome 1 0.910 0.642 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.