DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and RGD1562036

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_001062262.1 Gene:RGD1562036 RGDID:1562036 Length:425 Species:Rattus norvegicus

Alignment Length:391 Identity:157/392 (40%)
Similarity:230/392 (59%) Gaps:19/392 (5%)


  Fly    13 RELNIRRVIEECDLQRLDQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLG 77
            |:|.::: |::..:........:.||..:..:.:.:.:.|||:.||||||||:.|.::.:||.||
  Rat    33 RQLVLKK-IQDLSISGHQDPFMVADLDVLASRHQTFLQALPRVWPFYAVKCNNRPSLLLVLAALG 96

  Fly    78 AGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNS 142
            .||||||:.|::.|||..|:|.||||||||:.|||::||....|...|.|:|.|:.||..|:|.:
  Rat    97 TGFDCASQGELEQVLGLGVAPSRIIFANPCKAVSHIQYAARCGVQLLTFDSEEELTKLARHHPGA 161

  Fly   143 NLIVRFKSEAKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIK 207
            .||:|.::....:..||..|||... :....|:.:|:.|.|.|.|.||||||.|...|:|.:||.
  Rat   162 RLILRIQTLGGRSTFPLHTKFGARL-LACGRLLQVARELGLAVVGASFHVGSDCHTPQSYRQAIA 225

  Fly   208 KAKNLFKFGALLGYDMDFLDIGGGFPG--SDDVKFEKIAESVNTSVQRHFPD-ERVHIIAEPGRF 269
            ....:|:.|...|:.|..||:||||||  ..:.|||::|..||.::.::||: ..|.:|||||||
  Rat   226 DCHRVFEMGCKAGHQMSLLDLGGGFPGIEGSEAKFEEMARVVNAALAQYFPEGTGVEVIAEPGRF 290

  Fly   270 FVAAACTLVCKIHAKREIRNEAGKLDTVMYYLNDGVYGSFNCILYDH----QVVIAEHYLDNAES 330
            :..:.||....|.||: ...|.|....:.||||:|.||:|...|.|.    .:|:.|     ..|
  Rat   291 YAESVCTAAVNIIAKK-ASLEPGGHRKLAYYLNEGHYGAFRIFLRDPVPRIPIVVKE-----LPS 349

  Fly   331 LPHL-KSLIWGPSCDALDKI-SEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYFQA 393
            .||| ...::||:|||.|:: |.::.||.|:.||.|.|.:||||...::|.||||  |.|..:.|
  Rat   350 DPHLFPCTLYGPTCDAFDRLFSTEVQLPELDVGDWLVFPDMGAYRSTMSSTFNGF--PITTVYDA 412

  Fly   394 I 394
            :
  Rat   413 M 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 154/384 (40%)
PLPDE_III_ODC 30..391 CDD:143482 153/370 (41%)
RGD1562036XP_001062262.1 LysA 48..410 CDD:223098 153/371 (41%)
PLPDE_III_ODC 50..410 CDD:143482 153/369 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37117360
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 322 1.000 Inparanoid score I2387
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T131175
orthoMCL 1 0.900 OOG5_126750
Panther 1 1.100 O PTHR11482
Phylome 1 0.910 0.627 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.