DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and spe1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_594665.1 Gene:spe1 PomBaseID:SPAC144.04c Length:432 Species:Schizosaccharomyces pombe

Alignment Length:388 Identity:166/389 (43%)
Similarity:241/389 (62%) Gaps:25/389 (6%)


  Fly    18 RRVIEECDLQRL------DQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQL 76
            :..|||.:...:      ..|..:.||:.|.|:|..|...|||::||||||||.||.|:.||.:.
pombe    48 KNTIEEIERAAVRGEPADSDAFFVADLNGVYRQLLRWHAKLPRVQPFYAVKCNPDPKVLALLNKF 112

  Fly    77 GAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPN 141
            |.|||||||.|::.:||..|||:||::||||:.::::.||....::..|.||..|:||:..|:||
pombe   113 GTGFDCASKGELEQILGLGVSPDRIVYANPCKAITYVRYAASKGINLMTFDNADELYKVKQHHPN 177

  Fly   142 SNLIVRFKSEAKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAI 206
            |.|::|..::...:.|.|..|||...| |...|:.:||||||.|.|.|||||||..:..|:..||
pombe   178 SRLLLRISTDDSNSLCRLSLKFGASLD-DTGKLLDIAKSLELNVVGVSFHVGSGSYDPSAFLDAI 241

  Fly   207 KKAKNLFKFGALLGYDMDFLDIGGGFPGSDDVKFEKIAESVNTSVQRHFPDERVHIIAEPGRFFV 271
            ::::.:|..|...|::.|.|||||||...   .|:.:|:.:.:::..:| |..:.:|:|||||||
pombe   242 QRSRQVFDQGLERGFNFDLLDIGGGFMND---SFDGVADLIRSALDTYF-DPSIRVISEPGRFFV 302

  Fly   272 AAACTLVCKIHAKREIRNEAGKLDTVMYYLNDGVYGSFNCILYDHQVVIAE--------HYLDNA 328
            :::.||...:.|||::.:|    :.||||:|||||||.||||:|||..:|.        .|.|..
pombe   303 SSSFTLAVNVIAKRKLDDE----EKVMYYVNDGVYGSLNCILFDHQHPVARVLKCGSRFVYNDLV 363

  Fly   329 ESLPHLKSLIWGPSCDALDKISEDLHLP-NLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLY 390
            .:..| :..||||:||:||.|:.|.||| .||.||.:.|.:.||||:..||.||||:..:.:|
pombe   364 GTGQH-RCFIWGPTCDSLDVIANDAHLPYELNVGDWIYFEDAGAYTVAAASCFNGFKTSRIVY 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 166/389 (43%)
PLPDE_III_ODC 30..391 CDD:143482 163/371 (44%)
spe1NP_594665.1 LysA 40..426 CDD:223098 166/389 (43%)
PLPDE_III_ODC 67..426 CDD:143482 163/370 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1906
Inparanoid 1 1.050 312 1.000 Inparanoid score I565
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T631484
orthoMCL 1 0.900 OOG5_126750
Panther 1 1.100 LDO PTHR11482
Phylome 1 0.910 0.712 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R297
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.