DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and Odc1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001289012.1 Gene:Odc1 RGDID:3227 Length:461 Species:Rattus norvegicus

Alignment Length:386 Identity:176/387 (45%)
Similarity:238/387 (61%) Gaps:26/387 (7%)


  Fly    29 LDQALN------------ICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFD 81
            |||.:|            :.||..|.:|...|.|.|||:.|||||||||...:|..||.:|.|||
  Rat    24 LDQKINEVSSSDDKDAFYVADLGDVLKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFD 88

  Fly    82 CASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIV 146
            ||||.|::||.|..|.|||||:||||:.||.::||..:.|...|.|:|.|:.|:...:|.:.|::
  Rat    89 CASKTEIQLVQGLGVPPERIIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVL 153

  Fly   147 RFKSEAKEAQCPLGDKFGCDADVDAAALML-LAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAK 210
            |..::..:|.|.|..|||  |.:..:.|:| .||.|.:.|.|.||||||||::.:.:.:|:..|:
  Rat   154 RIATDDSKAVCRLSVKFG--ATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDAR 216

  Fly   211 NLFKFGALLGYDMDFLDIGGGFPGSDD--VKFEKIAESVNTSVQRHFP-DERVHIIAEPGRFFVA 272
            .:|..|..:|:.|..||||||||||:|  :|||:|...:|.::.::|| |..|.|||||||::||
  Rat   217 CVFDMGTEVGFSMYLLDIGGGFPGSEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVA 281

  Fly   273 AACTLVCKIHAKREI-RNEAGKLD-------TVMYYLNDGVYGSFNCILYDHQVVIAEHYLDNAE 329
            :|.||...|.||:.: :.:.|..|       |:|||:|||||||||||||||..|.|........
  Rat   282 SAFTLAVNIIAKKTVWKEQTGSDDEDESNEQTLMYYVNDGVYGSFNCILYDHAHVKALLQKRPKP 346

  Fly   330 SLPHLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLY 390
            ...:..|.||||:||.||:|.|...||.::.||.:.|.||||||:..||.||||:.|...|
  Rat   347 DEKYYSSSIWGPTCDGLDRIVERCSLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYY 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 176/387 (45%)
PLPDE_III_ODC 30..391 CDD:143482 175/386 (45%)
Odc1NP_001289012.1 PLPDE_III_ODC 37..408 CDD:143482 169/362 (47%)
LysA 40..408 CDD:223098 168/359 (47%)
Pyridoxal phosphate binding. {ECO:0000250|UniProtKB:P11926} 274..277 1/3 (33%)
Substrate binding. {ECO:0000250|UniProtKB:P07805} 331..332 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37116182
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 1 1.000 H1906
Inparanoid 1 1.050 322 1.000 Inparanoid score I2387
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T131175
orthoMCL 1 0.900 OOG5_126750
Panther 1 1.100 LDO PTHR11482
Phylome 1 0.910 0.632 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.