DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and Azin2

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_766463.1 Gene:Azin2 MGIID:2442093 Length:459 Species:Mus musculus

Alignment Length:409 Identity:148/410 (36%)
Similarity:233/410 (57%) Gaps:21/410 (5%)


  Fly     1 MAAATPEIQF--YERELNIRRVIEECDLQRLDQALN-------ICDLSSVERKLRLWQKLLPRIK 56
            ||....|..|  .|...:.|.::||..| ...||.:       :.||.:|.||...:.|.|||::
Mouse     1 MAGYLSESDFVMVEEGFSTRDLLEELTL-GASQATSGKVAAFFVADLGAVVRKHFCFLKHLPRVR 64

  Fly    57 PFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQV 121
            |||||.||....|:::||:||.||.||:|.|::||....|...:||.||||:.|:.::||.:|.|
Mouse    65 PFYAVGCNSSLGVLKVLAELGLGFSCANKAEMELVQHIGVPASKIICANPCKQVAQIKYAAKHGV 129

  Fly   122 SNGTVDNEFEVYKLHTHYPNSNLIVRFKSEAKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVT 186
            ...:.|||.|:.|:...:|::.:::...::...:...|..:||.... ....|:..||...::|.
Mouse   130 RLLSFDNEVELAKVVKSHPSAKMVLCIATQDSHSLNHLSLRFGASLK-SCRHLLENAKKSHVEVV 193

  Fly   187 GTSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPGSD--DVKFEKIAESVNT 249
            |.|||:||||.:.|||.::|..|:.:|:.|..||:.|:.||:||||||.:  .|:||::|..:|:
Mouse   194 GVSFHIGSGCPDPQAYAQSIADARLVFQMGEELGHTMNILDLGGGFPGLEGAKVRFEEMASVINS 258

  Fly   250 SVQRHFPDE-RVHIIAEPGRFFVAAACTLVCKIHAKREIRNEAGKLD-------TVMYYLNDGVY 306
            ::..:||:. .|.|:||.||::|.:|.|:...|.||||:.::|.:.:       :::|||::|||
Mouse   259 ALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKREVLDQASREEQTGAAPKSIVYYLDEGVY 323

  Fly   307 GSFNCILYDHQVVIAEHYLDNAESLPHLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGA 371
            |.||.:|:|:...........:...|...|.:|||:.:..|.::|.|.||.|..||.|.|.||||
Mouse   324 GVFNSVLFDNTCPTPALQKKPSADQPLYSSSLWGPAVEGCDCVAEGLWLPQLQVGDWLVFDNMGA 388

  Fly   372 YTMPIASAFNGFEVPKTLY 390
            ||:...|...|.:..:..|
Mouse   389 YTVDTKSLLGGTQARRVTY 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 143/393 (36%)
PLPDE_III_ODC 30..391 CDD:143482 139/379 (37%)
Azin2NP_766463.1 PLPDE_III_ODC 40..407 CDD:143482 136/368 (37%)
Necessary for polyamine uptake stimulation 117..140 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37147583
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 317 1.000 Inparanoid score I2513
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T130933
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11482
Phylome 1 0.910 0.636 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.870

Return to query results.
Submit another query.