DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and Odc1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_038642.2 Gene:Odc1 MGIID:97402 Length:461 Species:Mus musculus

Alignment Length:386 Identity:172/387 (44%)
Similarity:236/387 (61%) Gaps:26/387 (7%)


  Fly    29 LDQALN------------ICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFD 81
            |||.:|            :.||..:.:|...|.|.|||:.|||||||||...:|..||.:|.|||
Mouse    24 LDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFD 88

  Fly    82 CASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIV 146
            ||||.|::||.|..|..||:|:||||:.||.::||..:.|...|.|:|.|:.|:...:|.:.|::
Mouse    89 CASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVL 153

  Fly   147 RFKSEAKEAQCPLGDKFGCDADVDAAALML-LAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAK 210
            |..::..:|.|.|..|||  |.:..:.|:| .||.|.:.|.|.||||||||::.:.:.:|:..|:
Mouse   154 RIATDDSKAVCRLSVKFG--ATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDAR 216

  Fly   211 NLFKFGALLGYDMDFLDIGGGFPGSDD--VKFEKIAESVNTSVQRHFP-DERVHIIAEPGRFFVA 272
            .:|.....:|:.|..||||||||||:|  :|||:|...:|.::.::|| |..|.|||||||::||
Mouse   217 CVFDMATEVGFSMHLLDIGGGFPGSEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVA 281

  Fly   273 AACTLVCKIHAKREI-RNEAGKLD-------TVMYYLNDGVYGSFNCILYDHQVVIAEHYLDNAE 329
            :|.||...|.||:.: :.:.|..|       |.|||:|||||||||||||||..|.|........
Mouse   282 SAFTLAVNIIAKKTVWKEQPGSDDEDESNEQTFMYYVNDGVYGSFNCILYDHAHVKALLQKRPKP 346

  Fly   330 SLPHLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLY 390
            ...:..|.||||:||.||:|.|..:||.::.||.:.|.||||||:..||.||||:.|...|
Mouse   347 DEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYY 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 172/387 (44%)
PLPDE_III_ODC 30..391 CDD:143482 171/386 (44%)
Odc1NP_038642.2 PLPDE_III_ODC 37..408 CDD:143482 166/362 (46%)
LysA 40..408 CDD:223098 165/359 (46%)
Pyridoxal phosphate binding. {ECO:0000269|PubMed:10378276} 274..277 1/3 (33%)
Substrate binding. {ECO:0000250|UniProtKB:P07805} 331..332 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37147507
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 1 1.000 H1906
Inparanoid 1 1.050 317 1.000 Inparanoid score I2513
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T130933
orthoMCL 1 0.900 OOG5_126750
Panther 1 1.100 LDO PTHR11482
Phylome 1 0.910 0.640 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R297
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.