DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and odc-1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_504752.1 Gene:odc-1 WormBaseID:WBGene00003844 Length:422 Species:Caenorhabditis elegans

Alignment Length:383 Identity:166/384 (43%)
Similarity:230/384 (60%) Gaps:13/384 (3%)


  Fly    18 RRVIEECDLQRLDQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDC 82
            |.:....|||..|.:..:.||..:..:.:||::.||.|:||||||||.|.:::|:||.||.||||
 Worm    27 RDIAASKDLQENDSSFMLVDLDKIIERFQLWKRELPMIEPFYAVKCNTDLVLIRILASLGCGFDC 91

  Fly    83 ASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVR 147
            |||:|:.:|:|..||.||||:||||:..|.:.:|.:..|...|.||..|:.|:...:||:.:|:|
 Worm    92 ASKDEIDIVMGTGVSAERIIYANPCKTRSFIAHAMDRDVKMMTFDNPEELLKIAKLHPNAEMILR 156

  Fly   148 FKSEAKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKNL 212
            .......|.|||..|||.|..:.|..|:..|....:.|.|.||||||||::..||..|::.||||
 Worm   157 IAVSDPTATCPLNLKFGADPIIAAPQLLKTASEEGINVVGISFHVGSGCNDASAYRNALQHAKNL 221

  Fly   213 FKFGALLGYDMDFLDIGGGFPGSDDVK-FEKIAESVNTSVQRHFPDERVHIIAEPGRFFVAAACT 276
            .:.|..||:.||.:|:||||||::... ||||||::..::...|||....:||||||||.|...:
 Worm   222 CEIGEGLGFKMDIIDMGGGFPGAEHHNPFEKIAETIRDALDEFFPDTNKRLIAEPGRFFAAGPFS 286

  Fly   277 LVCKIHAKREIRNEAGKLDT---------VMYYLNDGVYGSFNCILYDHQVVIAEHYLDNAESLP 332
            ||..|....|:  .|.|:..         .|||:||||||||||||:||...|.....|...: .
 Worm   287 LVANIIHATEV--PASKITKDPKDCADHGYMYYINDGVYGSFNCILFDHAHPIGSPLFDTDRN-E 348

  Fly   333 HLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLY 390
            ...|.||||:||:||.:.:...:|.:|.|:.|.:.:|||||:..|:.||||..|..:|
 Worm   349 KFMSTIWGPTCDSLDLVEDKKLMPKMNVGEWLYYPDMGAYTLAAATTFNGFSKPVPMY 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 166/384 (43%)
PLPDE_III_ODC 30..391 CDD:143482 162/372 (44%)
odc-1NP_504752.1 LysA 17..402 CDD:223098 164/378 (43%)
PLPDE_III_ODC 39..407 CDD:143482 162/372 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C35365738
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H1906
Inparanoid 1 1.050 318 1.000 Inparanoid score I1486
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T375065
orthoMCL 1 0.900 OOG5_126750
Panther 1 1.100 LDO PTHR11482
Phylome 1 0.910 0.697 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R297
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.