DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and F53F10.2

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_740833.1 Gene:F53F10.2 WormBaseID:WBGene00018764 Length:477 Species:Caenorhabditis elegans

Alignment Length:389 Identity:104/390 (27%)
Similarity:177/390 (45%) Gaps:32/390 (8%)


  Fly    18 RRVIEECDLQRLDQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLA-QLGAGFD 81
            |.|...|...   |...:.|::::||:|...:.:|||::|.|||.||.||::.|:|: .:...|:
 Worm    45 RHVAARCGSY---QPFFVMDVAAIERRLEALRVMLPRVRPNYAVACNADPVLARVLSNNIDVNFE 106

  Fly    82 CASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIV 146
            .::..|::|| ..:|.|.|.:|.:.......::.|.....|...|::|.:|..:....|.:.:|:
 Worm   107 VSNTAELELV-SMNVEPSRAVFCSQLMTRKAIKNAVLAGCSTFVVESEKQVTDVMNASPEAEIIL 170

  Fly   147 RFKSEAKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKN 211
            .........:.|    |||..| :...::.:|..|...|||....:|...: |:.|..::..|::
 Worm   171 AVCLPYSTGEVP----FGCSVD-EIEEILDMAHLLGANVTGIYLELGLRAT-LEDYITSVHDARS 229

  Fly   212 LF-----KFGALLGYDMDFLDIGGGFPGSDDVKFEKIAESVNTSVQRHFPDERVHIIAEPGRFFV 271
            :|     ||..|.......|.:..|..|:.:.:|.....|:|..:...| :..:...|..|||.|
 Worm   230 IFETADQKFLTLRRVCFGNLSVPTGADGAVNNEFMSFCNSLNNVIDDLF-ESNIDFSASIGRFLV 293

  Fly   272 AAACTLVCKIHAKRE-----IRNEAGKLDT---VMYYLNDGVYGSFNCILYDHQVVIAEHYLDN- 327
            ..|.||...:..||.     |.|:  ..|.   .:|..||||||||.|...|.:.:.....::| 
 Worm   294 TNAFTLCTNVIGKRAMDAKFITND--DFDDGVGFVYQTNDGVYGSFGCKQMDIKPLCKPLDVEND 356

  Fly   328 AESLPHLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYF 391
            :|...|..::: ||:.|..|.....:....|..|:.|.:..|||:|:|:.|..:   ||...|:
 Worm   357 SEEQLHFGTIL-GPTLDGTDVAQRLMKSRQLRVGEWLVWEQMGAFTIPVDSEHS---VPPVYYY 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 104/388 (27%)
PLPDE_III_ODC 30..391 CDD:143482 101/376 (27%)
F53F10.2NP_740833.1 PLPDE_III 55..416 CDD:294187 101/375 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306092at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11482
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.