DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and odc1

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_571876.1 Gene:odc1 ZFINID:ZDB-GENE-010816-1 Length:461 Species:Danio rerio

Alignment Length:418 Identity:191/419 (46%)
Similarity:248/419 (59%) Gaps:32/419 (8%)


  Fly     1 MAAATP---EIQFYERELNIRRVIE----ECDLQRLDQALNICDLSSVERKLRLWQKLLPRIKPF 58
            |.|.|.   :..|.|.....|.::|    |..|.....|..:.||..|.:|...|.::||||.||
Zfish     1 MTACTGSDFDFAFLEEGFCARDIVEQKINESSLSDDKDAFYVADLGDVLKKHLRWLRVLPRITPF 65

  Fly    59 YAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSN 123
            |||||||...||..||.||||||||||.|:::|....|.|.|||:||||:.||.::||..|.|..
Zfish    66 YAVKCNDSRAVVTTLASLGAGFDCASKTEIQIVQSVGVDPSRIIYANPCKQVSQIKYASAHGVQM 130

  Fly   124 GTVDNEFEVYKLHTHYPNSNLIVRFKSEAKEAQCPLGDKFGCDADVDAAALML-LAKSLELKVTG 187
            .|.|:|.|:.|:...:.|:.|::|..::..:|.|.|..|||  |.:.::.|:| .||.|.|.|.|
Zfish   131 MTFDSEVELMKVARSHENAKLVLRIATDDSKAVCRLSVKFG--ATLKSSRLLLERAKELGLDVIG 193

  Fly   188 TSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPGSDD--VKFEKIAESVNTS 250
            .||||||||::.:.|.:||..|:.:|..||.|||:|..||||||||||:|  :|||:||..:|.:
Zfish   194 VSFHVGSGCTDPETYSQAISDARYVFDIGAELGYNMSLLDIGGGFPGSEDTKLKFEEIAAVINPA 258

  Fly   251 VQRHFP-DERVHIIAEPGRFFVAAACTLVCKIHAKREIRNEAGKLD---------TVMYYLNDGV 305
            :.::|| |..|.|||||||::||:|.||...|.||:.|..|....|         |:|||:||||
Zfish   259 LDKYFPVDSGVRIIAEPGRYYVASAYTLAVNIIAKKVIMKEQSASDEEEDVSNDRTLMYYVNDGV 323

  Fly   306 YGSFNCILYDHQVVIAEHYLDNAESLPH-----LKSLIWGPSCDALDKISEDLHLPNLNRGDLLG 365
            |||||||||||     .|.|......|.     ....||||:||.||:|.|...||::..||.|.
Zfish   324 YGSFNCILYDH-----AHVLPTLHKKPKPDERMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLL 383

  Fly   366 FRNMGAYTMPIASAFNGFEVPKTLYFQA 393
            |.||||||:..:|.||||:.|...|..:
Zfish   384 FENMGAYTVAASSTFNGFQKPDIYYIMS 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 186/397 (47%)
PLPDE_III_ODC 30..391 CDD:143482 182/379 (48%)
odc1NP_571876.1 PLPDE_III_ODC 37..409 CDD:143482 182/379 (48%)
LysA 40..409 CDD:223098 181/376 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37143993
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 1 1.000 H1906
Inparanoid 1 1.050 336 1.000 Inparanoid score I2332
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T128667
orthoMCL 1 0.900 OOG5_126750
Panther 1 1.100 LDO PTHR11482
Phylome 1 0.910 0.638 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R297
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.