DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and AZIN2

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001288754.1 Gene:AZIN2 HGNCID:29957 Length:480 Species:Homo sapiens

Alignment Length:431 Identity:152/432 (35%)
Similarity:235/432 (54%) Gaps:44/432 (10%)


  Fly     1 MAAATPEIQF--YERELNIRRVIEECDL----QRLDQ--ALNICDLSSVERKLRLWQKLLPRIKP 57
            ||....|..|  .|...:.|.:::|..|    ...|:  |..:.||.::.||...:.|.|||::|
Human     1 MAGYLSESDFVMVEEGFSTRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCLPRVRP 65

  Fly    58 FYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVS 122
            |||||||..|.|:::|||||.||.||:|.|::||....:...:||.||||:.::.::||.:|.:.
Human    66 FYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPASKIICANPCKQIAQIKYAAKHGIQ 130

  Fly   123 NGTVDNEFEVYKLHTHYPNSNLIVRFKSEAKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVTG 187
            ..:.|||.|:.|:...:|::.:::...::...:...|..|||.... ....|:..||...::|.|
Human   131 LLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSLSCLSLKFGVSLK-SCRHLLENAKKHHVEVVG 194

  Fly   188 TSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPGSD--DVKFEKIAESVNTS 250
            .|||:||||.:.|||.::|..|:.:|:.|..||:.|..||:||||||::  .|:||:||..:|::
Human   195 VSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFPGTEGAKVRFEEIASVINSA 259

  Fly   251 VQRHFPDE-RVHIIAEPGRFFVAAACTLVCKIHAKREI--------------------------- 287
            :..:||:. .|.|.||.||::|.:|.|:...|.||:|:                           
Human   260 LDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLDQPGREAPLPPPHIATCAASEPSPP 324

  Fly   288 RNEAGKLD-TVMYYLNDGVYGSFNCILYDHQVVIAEHYLDNAESL--PHLKSLIWGPSCDALDKI 349
            ..|.|... |::|:|::||||.||.:|:|:  :.....|....|.  |...|.:|||:.|..|.:
Human   325 AEENGSTSKTIVYHLDEGVYGIFNSVLFDN--ICPTPILQKKPSTEQPLYSSSLWGPAVDGCDCV 387

  Fly   350 SEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLY 390
            :|.|.||.|:.||.|.|.||||||:.:.|.|.|.:.....|
Human   388 AEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITY 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 147/415 (35%)
PLPDE_III_ODC 30..391 CDD:143482 144/397 (36%)
AZIN2NP_001288754.1 PLPDE_III_ODC 40..428 CDD:143482 142/391 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C37123843
eggNOG 1 0.900 E1_COG0019
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I2494
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 1 1.000 T130155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11482
Phylome 1 0.910 0.664 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.