DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and LOC108645845

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_017947319.1 Gene:LOC108645845 ID: Length:180 Species:Xenopus tropicalis

Alignment Length:163 Identity:57/164 (35%)
Similarity:92/164 (56%) Gaps:21/164 (13%)


  Fly   242 KIAESVNTSVQRHFPDER-VHIIAEPGRFFVAAACTLVCKIHAKREIRNEAGKLDT---VMYYLN 302
            |.|:.:..|:.::||:.: |.||:||||::|.:|.|:...|..|:|:..:....::   ..|.||
 Frog    19 KFADVIRQSLNQYFPNNKEVEIISEPGRYYVESAFTVALNIITKKEVYEKGADGNSRRKFSYILN 83

  Fly   303 DGVYGSFNCILYDHQVV---------IAEHYLDNAESLPHLKSLIWGPSCDALDKISEDLHLPNL 358
            |||||:|    .|..:|         :.:.:....|..|   |.:|||:|..:||:..:.:||.|
 Frog    84 DGVYGTF----LDFYLVKEKQKLKPLLGKDFATEQELFP---SNLWGPTCTNVDKLVNEFYLPEL 141

  Fly   359 NRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYF 391
            ..||.:.|.|||||::.:::.||||..|| :||
 Frog   142 ETGDWVIFPNMGAYSISMSTTFNGFPQPK-VYF 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 56/162 (35%)
PLPDE_III_ODC 30..391 CDD:143482 56/162 (35%)
LOC108645845XP_017947319.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306092at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.