DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and LOC100498594

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_012813617.1 Gene:LOC100498594 ID: Length:272 Species:Xenopus tropicalis

Alignment Length:266 Identity:108/267 (40%)
Similarity:152/267 (57%) Gaps:14/267 (5%)


  Fly    30 DQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGF 94
            :.|..:.||..:.:|...:.|.|||:|||||:|||....|:::||.||.||.|.|..|:.:||..
 Frog     8 EDAFYVADLGDIIKKYWQFSKGLPRVKPFYAMKCNSTRAVLQMLAFLGTGFACCSMAELDMVLRM 72

  Fly    95 DVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKSEAKEAQCPL 159
            .|....|:|.|||:.|||:.||.|:.|...|.|.|.|:.||...||.:.:|::..::.||....|
 Frog    73 GVPAADIVFVNPCKQVSHIRYAAEYGVRKMTFDCESELLKLAASYPQAEMILQIVTDNKEPWHTL 137

  Fly   160 GDKFG-----CDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKNLFKFGALL 219
            ....|     |:      .|:..||||.:.|.|.|||.||.|.:..::.:||:.|:.:|..|..|
 Frog   138 SGICGVYISECE------NLLKKAKSLNMDVFGVSFHTGSRCKDTHSFHKAIEDARKVFDIGKNL 196

  Fly   220 GYDMDFLDIGGGFPGSDDVK--FEKIAESVNTSVQRHFP-DERVHIIAEPGRFFVAAACTLVCKI 281
            |:.|..|||||||||..:.:  |||.||.:..|:.:.|| :|.|.||||||||:|.:|.|....|
 Frog   197 GHQMRLLDIGGGFPGDSESRPTFEKFAEVIRISLDQSFPCNEDVQIIAEPGRFYVTSAFTAALNI 261

  Fly   282 HAKREI 287
            ..|:.:
 Frog   262 VTKKVV 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 108/267 (40%)
PLPDE_III_ODC 30..391 CDD:143482 108/267 (40%)
LOC100498594XP_012813617.1 PLPDE_III_ODC 8..>267 CDD:143482 108/265 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.