DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Odc1 and LOC100498433

Sequence 1:NP_477052.2 Gene:Odc1 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_017947318.1 Gene:LOC100498433 ID: Length:240 Species:Xenopus tropicalis

Alignment Length:214 Identity:89/215 (41%)
Similarity:134/215 (62%) Gaps:3/215 (1%)


  Fly    32 ALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDV 96
            |..:.||..:::|...:.|.|||:|||||||||....|:::||.||.||||||..|:.:||...|
 Frog    14 AFYVADLGDIKQKHWRFMKELPRVKPFYAVKCNSTNEVLQMLATLGTGFDCASMGEIDMVLRMGV 78

  Fly    97 SPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKSEAKEAQCPLGD 161
            ....|::||||:.|||::||..|.|...|.|.|.|::|:...:|.:.:|:|..::.::|.|.|..
 Frog    79 PAADIVYANPCKQVSHIKYAAAHGVCKMTFDCEAELFKIAAFHPKAEMILRIATDDRDAWCALSS 143

  Fly   162 KFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFL 226
            |:|...: ....|:..||:|.::|.|.|||.||||....::.:||:.|:.:|:.|..|||.|..|
 Frog   144 KYGALVE-QCEDLLKTAKNLNIQVIGVSFHTGSGCKNTHSFCKAIEDARKVFEIGKKLGYQMRLL 207

  Fly   227 DIGGGFPGSDDVK--FEKI 243
            ||||||.|:.:.:  ||::
 Frog   208 DIGGGFSGNSEFRPTFEEV 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 LysA 16..391 CDD:223098 89/215 (41%)
PLPDE_III_ODC 30..391 CDD:143482 89/215 (41%)
LOC100498433XP_017947318.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306092at33208
OrthoFinder 1 1.000 FOG0001021
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.