| Sequence 1: | NP_523657.1 | Gene: | Hey / 35764 | FlyBaseID: | FBgn0027788 | Length: | 425 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001101447.1 | Gene: | Heyl / 313575 | RGDID: | 1305022 | Length: | 326 | Species: | Rattus norvegicus |
| Alignment Length: | 42 | Identity: | 15/42 - (35%) |
|---|---|---|---|
| Similarity: | 22/42 - (52%) | Gaps: | 6/42 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 157 SVPRMLQTINLRYVPYEECKRLLEDNPAVDLGHICTLTKEGE 198 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Hey | NP_523657.1 | bHLH_SF | 95..163 | CDD:469605 | 1/5 (20%) |
| ORANGE | 172..218 | CDD:128787 | 9/27 (33%) | ||
| Heyl | NP_001101447.1 | bHLH-O_HEYL | 36..109 | CDD:381453 | |
| ORANGE | 115..162 | CDD:128787 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||