DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and Heyl

DIOPT Version :10

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001101447.1 Gene:Heyl / 313575 RGDID:1305022 Length:326 Species:Rattus norvegicus


Alignment Length:42 Identity:15/42 - (35%)
Similarity:22/42 - (52%) Gaps:6/42 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SVPRMLQTINLRYVPYEECKRLLEDNPAVDLGHICTLTKEGE 198
            ::|.:|.|||    |.||.:.|.||:...|  |:.|:....|
  Rat  1465 TLPALLATIN----PCEERQLLSEDDEEDD--HLATINPSEE 1500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 bHLH_SF 95..163 CDD:469605 1/5 (20%)
ORANGE 172..218 CDD:128787 9/27 (33%)
HeylNP_001101447.1 bHLH-O_HEYL 36..109 CDD:381453
ORANGE 115..162 CDD:128787
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.