DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dic3 and CG1907

Sequence 1:NP_610344.2 Gene:Dic3 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster

Alignment Length:297 Identity:99/298 (33%)
Similarity:153/298 (51%) Gaps:37/298 (12%)


  Fly    11 RWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIH------ERSGILGFYNGISA 69
            ::.|||:....|.....|:||:|.::|.......|.  |....:|      .:.|.|..|.||.|
  Fly    20 KFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKK--EYRSSLHCIQTIVSKEGPLALYQGIGA 82

  Fly    70 SWFRQLTYTTTRFALYEAGKD-----YVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDV 129
            :..||.||||.|..:|....|     :..:..::..||:.|.||..|..:|.|.:|..||:.:|.
  Fly    83 ALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDG 147

  Fly   130 KLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVK--------QM 186
            :||..:||||.:|.:.|.||.:|||:::|:||::|.|.||:::.:...|:|.|.|        ||
  Fly   148 RLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQM 212

  Fly   187 LKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMN-----AQPGEFSGIGGAFLSTAKQ 246
                   .||:.|||..|.::|.:..:.:.|||:.||...|     .:| |:.|.....|..|:|
  Fly   213 -------EEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKP-EYRGTADVLLRVARQ 269

  Fly   247 -GPLAFYKGFIPALIRVSPNTIITFVLYEQARMRFGY 282
             |..|.:|||.|...|:.|:|::||::.||  :..||
  Fly   270 EGVFALWKGFTPYYCRLGPHTVLTFIILEQ--LNQGY 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 95/285 (33%)
Mito_carr 15..91 CDD:278578 26/87 (30%)
Mito_carr 93..187 CDD:278578 38/102 (37%)
Mito_carr 200..281 CDD:278578 29/87 (33%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 27/91 (30%)
Mito_carr 118..207 CDD:278578 36/89 (40%)
Mito_carr 219..307 CDD:278578 31/90 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2025756
eggNOG 1 0.900 E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D404074at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45618
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.